NKIRAS2 (NM_017595) Human Tagged ORF Clone

CAT#: RC209464

NKIRAS2 (Myc-DDK-tagged)-Human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2

Product Images

Circular map for RC209464

• 

  Western blot validation of overexpression lysate (Cat# LY428581) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC226742 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified NKIRAS2 protein (Cat# TP309464). The protein was produced from HEK293T cells transfected with NKIRAS2 cDNA clone (Cat# RC209464) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: NKIRAS2
• Synonyms: kappaB-Ras2; KBRAS2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC209464 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGGAAGAGCTGCAAGGTGGTCGTGTGTGGCCAGGCGTCTGTGGGCAAAACTTCAATCCTGGAGCAGC
  TTCTGTATGGGAACCATGTAGTGGGTTCGGAGATGATCGAGACGCAGGAGGACATCTACGTGGGCTCCAT
  TGAGACAGACCGGGGGGTGCGAGAGCAGGTGCGTTTCTATGACACCCGGGGGCTCCGAGATGGGGCCGAA
  CTGCCCCGACACTGCTTCTCTTGCACTGATGGCTACGTCCTGGTCTATAGCACAGATAGCAGAGAGTCTT
  TTCAGCGTGTGGAGCTGCTCAAGAAGGAGATTGACAAATCCAAGGACAAGAAGGAGGTCACCATCGTGGT
  CCTTGGCAACAAGTGTGACTTACAGGAGCAGCGGCGTGTAGACCCAGATGTGGCTCAGCACTGGGCCAAG
  TCAGAGAAGGTGAAGCTGTGGGAGGTGTCAGTGGCGGACCGGCGCTCCCTCCTGGAGCCCTTTGTCTACT
  TGGCCAGCAAGATGACGCAACCCCAGAGCAAGTCTGCCTTCCCCCTCAGCCGGAAGAACAAGGGCAGCGG
  CTCCTTGGATGGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC209464 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE
  LPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK
  SEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_017595
• ORF Size: 573 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_017595.6
• RefSeq Size: 2474 bp
• RefSeq ORF: 576 bp
• Locus ID: 28511
• UniProt ID: Q9NYR9
• Cytogenetics: 17q21.2
• Domains: RAS, RAB
• MW: 21.5 kDa
• Gene Summary: Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).[UniProtKB/Swiss-Prot Function]