FOXN2 (NM_002158) Human Tagged ORF Clone

CAT#: RC209269

FOXN2 (Myc-DDK-tagged)-Human forkhead box N2 (FOXN2)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name FOXN2 (NM_002158) Human Tagged ORF Clone
Symbol FOXN2
Synonyms HTLF; HTLF
Vector pCMV6-Entry
Sequence Data
>RC209269 representing NM_002158
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTCCAGTAATTGGAATGACTCCAGATAAGAGAGCTGAAACCCCAGGAGCTGAAAAGATTGCAGGAT
TAAGCCAGATTTACAAAATGGGAAGCTTGCCTGAAGCTGTTGATGCTGCCAGGCCGAAGGCCACTCTAGT
GGACAGTGAGTCAGCAGATGATGAACTCACAAACTTGAACTGGCTTCATGAAAGCACTAATCTTCTAACA
AACTTCAGCCTCGGAAGTGAGGGTCTTCCAATTGTTAGTCCATTGTATGACATAGAGGGAGATGATGTGC
CATCCTTTGGACCAGCTTGCTACCAGAACCCAGAAAAAAAATCAGCGACTTCAAAGCCCCCATACTCCTT
TAGTCTTCTCATTTATATGGCCATTGAGCACTCTCCAAATAAATGTTTGCCTGTCAAAGAAATTTATAGC
TGGATTCTGGACCATTTTCCATATTTTGCTACTGCACCAACAGGCTGGAAGAATTCTGTTCGACATAATC
TGTCCCTGAATAAATGTTTTCAGAAAGTGGAAAGAAGCCATGGCAAGGTTAATGGAAAAGGTTCCTTATG
GTGTGTTGATCCGGAATATAAACCCAATCTTATCCAGGCACTGAAGAAGCAACCTTTTTCTTCAGCATCT
TCACAAAATGGTTCTTTATCACCTCACTATTTAAGCTCTGTAATCAAGCAGAACCAGGTGCGAAACCTCA
AAGAATCTGATATTGATGCTGCTGCTGCAATGATGCTTTTAAATACTTCTATAGAACAAGGAATTTTAGA
ATGTGAGAAGCCTCTTCCTCTTAAAACAGCATTGCAAAAAAAGAGGAGTTACGGCAATGCATTTCATCAT
CCCAGTGCTGTACGATTACAAGAGAGTGATTCTTTAGCCACCAGCATTGATCCAAAAGAAGATCACAATT
ACAGTGCAAGTAGCATGGCAGCACAGCGTTGTGCATCCAGGTCTAGCGTGTCTTCTCTGTCTTCTGTGGA
TGAGGTATATGAATTTATCCCAAAGAATAGTCACGTGGGAAGTGATGGCAGTGAAGGATTTCACAGTGAA
GAAGATACAGACGTTGATTATGAAGATGATCCTCTTGGAGACAGTGGCTATGCATCACAGCCTTGTGCAA
AAATCTCTGAAAAAGGGCAGTCAGGCAAAAAGATGCGAAAACAGACATGTCAAGAAATTGATGAGGAGCT
CAAAGAGGCAGCTGGATCTCTGCTCCACCTTGCTGGAATTCGTACATGTTTAGGTTCCCTAATAAGTACT
GCAAAGACACAAAATCAAAAGCAACGGAAAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209269 representing NM_002158
Red=Cloning site Green=Tags(s)

MGPVIGMTPDKRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLNWLHESTNLLT
NFSLGSEGLPIVSPLYDIEGDDVPSFGPACYQNPEKKSATSKPPYSFSLLIYMAIEHSPNKCLPVKEIYS
WILDHFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSAS
SQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHH
PSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSE
EDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLIST
AKTQNQKQRKK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002158
ORF Size 1293 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002158.2, NM_002158.3, NP_002149
RefSeq Size 5472
RefSeq ORF 1296
Locus ID 3344
Cytogenetics 2p16.3
Domains FH
Protein Families Transcription Factors
MW 47 kDa
Gene Summary This gene encodes a forkhead domain binding protein and may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)