JMJD6 (NM_015167) Human Tagged ORF Clone

CAT#: RC208993

JMJD6 (Myc-DDK-tagged)-Human jumonji domain containing 6 (JMJD6), transcript variant 2

Change vector?

USD 515.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name JMJD6 (NM_015167) Human Tagged ORF Clone
Symbol JMJD6
Synonyms PSR; PTDSR; PTDSR1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208993 representing NM_015167
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCACAAGAGCAAGAAGCGCATCCGCGAGGCCAAGCGGAGTGCGCGGCCGGAGCTCAAGGACTCGC
TGGATTGGACCCGGCACAACTACTACGAGAGCTTCTCGCTGAGCCCGGCGGCCGTGGCGGATAACGTGGA
AAGGGCAGATGCTTTACAGCTGTCTGTGGAAGAATTTGTGGAGCGGTATGAAAGACCTTACAAGCCCGTG
GTTTTGTTGAATGCGCAAGAGGGCTGGTCTGCGCAGGAGAAATGGACTCTGGAGCGCCTAAAAAGGAAAT
ATCGGAACCAGAAGTTCAAGTGTGGTGAGGATAACGATGGCTACTCAGTGAAGATGAAGATGAAATACTA
CATCGAGTACATGGAGAGCACTCGAGATGATAGTCCCCTTTACATCTTTGACAGCAGCTATGGTGAACAC
CCTAAAAGAAGGAAACTTTTGGAAGACTACAAGGTGCCAAAGTTTTTCACTGATGACCTTTTCCAGTATG
CTGGGGAGAAGCGCAGGCCCCCTTACAGGTGGTTTGTGATGGGGCCACCACGCTCCGGAACTGGGATTCA
CATCGACCCTCTGGGAACCAGTGCCTGGAATGCCTTAGTTCAGGGCCACAAGCGCTGGTGCCTGTTTCCT
ACCAGCACTCCCAGGGAACTCATCAAAGTGACCCGAGACGAAGGAGGGAACCAGCAAGACGAAGCTATTA
CCTGGTTTAATGTTATTTATCCCCGGACACAGCTTCCAACCTGGCCACCTGAATTCAAACCCCTGGAAAT
CTTACAAAAACCAGGAGAGACTGTCTTTGTACCAGGAGGCTGGTGGCATGTTGTCCTCAATCTCGACACT
ACTATCGCCATCACCCAAAATTTTGCCAGCAGCACCAACTTCCCTGTGGTATGGCACAAGACGGTAAGAG
GGAGACCAAAGTTATCAAGGAAATGGTATAGGATTTTGAAGCAAGAGCACCCCGAGTTGGCAGTCCTCGC
AGACTCGGTTGACCTTCAGGAGTCCACAGGGATAGCTTCCGACAGCTCCAGCGACTCTTCCAGCTCCTCC
AGCTCCAGTTCGTCAGACTCCGACTCAGAGTGCGAGTCTGGATCCGAGGGCGATGGGACAGTGCACCGCA
GGAAGAAGAGGAGGACGTGCAGCATGGTGGGAAACGGGGACACCACCTCCCAGGACGACTGTGTCAGCAA
AGAGCGCAGCTCCTCCAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208993 representing NM_015167
Red=Cloning site Green=Tags(s)

MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV
VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH
PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP
TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT
TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS
SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015167
ORF Size 1209 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015167.2, NP_055982
RefSeq Size 1834
Locus ID 23210
Cytogenetics 17q25.1
Domains JmjC
Protein Families ES Cell Differentiation/IPS, Druggable Genome
MW 46.3 kDa
Gene Summary This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.