DCUN1D2 (NM_001014283) Human Tagged ORF Clone

CAT#: RC208865

DCUN1D2 (Myc-DDK-tagged)-Human DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) (DCUN1D2)

Change vector?

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DCUN1D2 (NM_001014283) Human Tagged ORF Clone
Symbol DCUN1D2
Synonyms C13orf17; C13orf17
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208865 representing NM_001014283
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATAAGCTTAAATCGTCTCAGAAGGACAAGGTCCGCCAGTTTATGGCGTGCACTCAGGCTGGCGAGA
GAACTGCTATCTACTGCTTAACGCAGAATGAGTGGAGACTAGACGAGGCCACGGACAGCTTCTTCCAAAA
CCCAGACTCGCTCCACAGGGAGTCCATGCGGAACGCTGTGGACAAGAAGAAGCTGGAGCGGCTGTACGGC
AGGTACAAAGATCCACAAGATGAAAACAAAATTGGAGTCGATGGGATTCAACAGTTTTGTGATGATCTGA
GCCTGGATCCTGCCAGTATCAGTGTATTGGTCATAGCGTGGAAGTTCAGGGCAGCAACTCAGTGTGAATT
TAGCAGAAAGGAATTTCTAGATGGCATGACAGAACTTGGGTGTGACAGCATGGAGAAGCTAAAGGCTCTT
CTGCCAAGACTGGAGCAGGAGCTGAAGGACACAGCCAAGTTTAAAGATTTTTATCAGTTTACCTTCACCT
TCGCTAAGAACCCAGGGCAGAAAGGTTTAGACTTAGAAATGGCTGTTGCGTATTGGAAATTAGTGTTATC
TGGAAGGTTTAAATTTTTAGATCTCTGGAACACATTCTTAATGGAACATCACAAAAGATCAATTCCAAGG
GACACCTGGAACCTCCTGCTGGACTTTGGAAACATGATTGCGGATGATATGTCTAACTACGATGAAGAAG
GAGCTTGGCCCGTTCTTATAGATGATTTTGTAGAATATGCACGGCCAGTAGTCACAGGTGGAAAACGCAG
CCTTTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208865 representing NM_001014283
Red=Cloning site Green=Tags(s)

MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYG
RYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKAL
LPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPR
DTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001014283
ORF Size 777 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001014283.1, NP_001014305
RefSeq Size 3046
RefSeq ORF 780
Locus ID 55208
Cytogenetics 13q34
MW 30 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations