MEF2D (NM_005920) Human Tagged ORF Clone

CAT#: RC208748

Reviews ()
Write a review

MEF2D (Myc-DDK-tagged)-Human myocyte enhancer factor 2D (MEF2D)



Reconstitution Protocol

USD 485.00

In Stock*

Size
    • 10 ug

Product images

Other products for "MEF2D"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MEF2D
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208748 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAGGAAAAAGATTCAGATCCAGCGAATCACCGACGAGCGGAACCGACAGGTGACTTTCACCAAGC
GGAAGTTTGGCCTGATGAAGAAGGCGTATGAGCTGAGCGTGCTATGTGACTGCGAGATCGCACTCATCAT
CTTCAACCACTCCAACAAGCTGTTCCAGTACGCCAGCACCGACATGGACAAGGTGCTGCTCAAGTACACG
GAGTACAATGAGCCACACGAGAGCCGCACCAACGCCGACATCATCGAGACCCTGAGGAAGAAGGGCTTCA
ATGGCTGCGACAGCCCCGAGCCCGACGGGGAGGACTCGCTGGAACAGAGCCCCCTGCTGGAGGACAAGTA
CCGACGCGCCAGCGAGGAGCTCGACGGGCTCTTCCGGCGCTATGGGTCAACTGTCCCGGCCCCCAACTTT
GCCATGCCTGTCACGGTGCCCGTGTCCAATCAGAGCTCACTGCAGTTCAGCAATCCCAGCGGCTCCCTGG
TCACCCCTTCCCTGGTGACATCATCCCTCACGGACCCGCGGCTCCTGTCCCCCCAGCAGCCAGCACTACA
GAGGAACAGTGTGTCTCCTGGCCTGCCCCAGCGGCCAGCTAGTGCGGGGGCCATGCTGGGGGGTGACCTG
AACAGTGCTAACGGAGCCTGCCCCAGCCCTGTTGGGAATGGCTACGTCAGTGCTCGGGCTTCCCCTGGCC
TCCTCCCTGTGGCCAATGGCAACAGCCTAAACAAGGTCATCCCTGCCAAGTCTCCGCCCCCACCTACCCA
CAGCACCCAGCTTGGAGCCCCCAGCCGCAAGCCCGACCTGCGAGTCATCACTTCCCAGGCAGGAAAGGGG
TTAATGCATCACTTGACTGAGGACCATTTAGATCTGAACAATGCCCAGCGCCTTGGGGTCTCCCAGTCTA
CTCATTCGCTCACCACCCCAGTGGTTTCTGTGGCAACGCCGAGTTTACTCAGCCAGGGCCTCCCCTTCTC
TTCCATGCCCACTGCCTACAACACAGATTACCAGTTGACCAGTGCAGAGCTCTCCTCCTTACCAGCCTTT
AGTTCACCTGGGGGGCTGTCGCTAGGCAATGTCACTGCCTGGCAACAGCCACAGCAGCCCCAGCAGCCGC
AGCAGCCACAGCCTCCACAGCAGCAGCCACCGCAGCCACAGCAGCCACAGCCACAGCAGCCTCAGCAGCC
GCAACAGCCACCTCAGCAACAGTCCCACCTGGTCCCTGTATCTCTCAGCAACCTCATCCCGGGCAGCCCC
CTGCCCCACGTGGGTGCTGCCCTCACAGTCACCACCCACCCCCACATCAGCATCAAGTCAGAACCGGTGT
CCCCAAGCCGTGAGCGCAGCCCTGCGCCTCCCCCTCCAGCTGTGTTCCCAGCTGCCCGCCCTGAGCCTGG
CGATGGTCTCAGCAGCCCAGCCGGGGGATCCTATGAGACGGGAGACCGGGATGACGGACGGGGGGACTTC
GGGCCCACACTGGGCCTGCTGCGCCCAGCCCCAGAGCCTGAGGCTGAGGGCTCAGCTGTGAAGAGGATGC
GGCTTGATACCTGGACATTAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208748 protein sequence
Red=Cloning site Green=Tags(s)

MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYT
EYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNF
AMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDL
NSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKG
LMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAF
SSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDF
GPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005920
ORF Size 1563 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005920.2, NP_005911.1
RefSeq Size 5996 bp
RefSeq ORF 1566 bp
Locus ID 4209
UniProt ID Q14814
Cytogenetics 1q22
Protein Families Transcription Factors
MW 55.9 kDa
Gene Summary This gene is a member of the myocyte-specific enhancer factor 2 (MEF2) family of transcription factors. Members of this family are involved in control of muscle and neuronal cell differentiation and development, and are regulated by class II histone deacetylases. Fusions of the encoded protein with Deleted in Azoospermia-Associated Protein 1 (DAZAP1) due to a translocation have been found in an acute lymphoblastic leukemia cell line, suggesting a role in leukemogenesis. The encoded protein may also be involved in Parkinson disease and myotonic dystrophy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.