Oct-1(POU2F1) (NM_002697) Human Tagged ORF Clone

CAT#: RC208599

POU2F1 (Myc-DDK-tagged)-Human POU class 2 homeobox 1 (POU2F1), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Oct-1(POU2F1) (NM_002697) Human Tagged ORF Clone
Symbol POU2F1
Synonyms oct-1B; OCT1; OTF1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC208599 representing NM_002697
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAATCCGTCAGAAACCAGTAAACCATCTATGGAGAGTGGAGATGGCAACACAGGCACACAAACCA
ATGGTCTGGACTTTCAGAAGCAGCCTGTGCCTGTAGGAGGAGCAATCTCAACAGCCCAGGCGCAGGCTTT
CCTTGGACATCTCCATCAGGTCCAACTCGCTGGAACAAGTTTACAGGCTGCTGCTCAGTCTTTAAATGTA
CAGTCTAAATCTAATGAAGAATCGGGGGATTCGCAGCAGCCAAGCCAGCCTTCCCAGCAGCCTTCAGTGC
AGGCAGCCATTCCCCAGACCCAGCTTATGCTAGCTGGAGGACAGATAACTGGGCTTACTTTGACGCCTGC
CCAGCAACAGTTACTACTCCAGCAGGCACAGGCACAGGCACAGCTGCTGGCTGCTGCAGTGCAGCAGCAC
TCCGCCAGCCAGCAGCACAGTGCTGCTGGAGCCACCATCTCCGCCTCTGCTGCCACGCCCATGACGCAGA
TCCCCCTGTCTCAGCCCATACAGATCGCACAGGATCTTCAACAACTGCAACAGCTTCAACAGCAGAATCT
CAACCTGCAACAGTTTGTGTTGGTGCATCCAACCACCAATTTGCAGCCAGCGCAGTTTATCATCTCACAG
ACGCCCCAGGGCCAGCAGGGTCTCCTGCAAGCGCAAAATCTTCTAACGCAACTACCTCAGCAAAGCCAAG
CCAACCTCCTACAGTCGCAGCCAAGCATCACCCTCACCTCCCAGCCAGCAACCCCAACACGCACAATAGC
AGCAACCCCAATTCAGACACTTCCACAGAGCCAGTCAACACCAAAGCGAATTGATACTCCCAGCTTGGAG
GAGCCCAGTGACCTTGAGGAGCTTGAGCAGTTTGCCAAGACCTTCAAACAAAGACGAATCAAACTTGGAT
TCACTCAGGGTGATGTTGGGCTCGCTATGGGGAAACTATATGGAAATGACTTCAGCCAAACTACCATCTC
TCGATTTGAAGCCTTGAACCTCAGCTTTAAGAACATGTGCAAGTTGAAGCCACTTTTAGAGAAGTGGCTA
AATGATGCAGAGAACCTCTCATCTGATTCGTCCCTCTCCAGCCCAAGTGCCCTGAATTCTCCAGGAATTG
AGGGCTTGAGCCGTAGGAGGAAGAAACGCACCAGCATAGAGACCAACATCCGTGTGGCCTTAGAGAAGAG
TTTCTTGGAGAATCAAAAGCCTACCTCGGAAGAGATCACTATGATTGCTGATCAGCTCAATATGGAAAAA
GAGGTGATTCGTGTTTGGTTCTGTAACCGCCGCCAGAAAGAAAAAAGAATCAACCCACCAAGCAGTGGTG
GGACCAGCAGCTCACCTATTAAAGCAATTTTCCCCAGCCCAACTTCACTGGTGGCGACCACACCAAGCCT
TGTGACTAGCAGTGCAGCAACTACCCTCACAGTCAGCCCTGTCCTCCCTCTGACCAGTGCTGCTGTGACG
AATCTTTCAGTTACAGGCACTTCAGACACCACCTCCAACAACACAGCAACCGTGATTTCCACAGCGCCTC
CAGCTTCCTCAGCAGTCACGTCCCCCTCTCTGAGTCCCTCCCCTTCTGCCTCAGCCTCCACCTCCGAGGC
ATCCAGTGCCAGTGAGACCAGCACAACACAGACCACCTCCACTCCTTTGTCCTCCCCTCTTGGGACCAGC
CAGGTGATGGTGACAGCATCAGGTTTGCAAACAGCAGCAGCTGCTGCCCTTCAAGGAGCTGCACAGTTGC
CAGCAAATGCCAGTCTTGCTGCCATGGCAGCTGCTGCAGGACTAAACCCAAGCCTGATGGCACCCTCACA
GTTTGCGGCTGGAGGTGCCTTACTCAGTCTGAATCCAGGGACCCTGAGCGGTGCTCTCAGCCCAGCTCTA
ATGAGCAACAGTACACTGGCAACTATTCAAGCTCTTGCTTCTGGTGGCTCTCTTCCAATAACATCACTTG
ATGCAACTGGGAACCTGGTATTTGCCAATGCGGGAGGAGCCCCCAACATCGTGACTGCCCCTCTGTTCCT
GAACCCTCAGAACCTCTCTCTGCTCACCAGCAACCCTGTTAGCTTGGTCTCTGCCGCCGCAGCATCTGCA
GGGAACTCTGCACCTGTAGCCAGCCTTCACGCCACCTCCACCTCTGCTGAGTCCATCCAGAACTCTCTCT
TCACAGTGGCCTCTGCCAGCGGGGCTGCGTCCACCACCACCACCGCCTCCAAGGCACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208599 representing NM_002697
Red=Cloning site Green=Tags(s)

MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNV
QSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQH
SASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTNLQPAQFIISQ
TPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLE
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWL
NDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSPVLPLTSAAVT
NLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETSTTQTTSTPLSSPLGTS
QVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNPSLMAPSQFAAGGALLSLNPGTLSGALSPAL
MSNSTLATIQALASGGSLPITSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASA
GNSAPVASLHATSTSAESIQNSLFTVASASGAASTTTTASKAQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002697
ORF Size 2229 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002697.1, NM_002697.2, NP_002688
RefSeq Size 2689
RefSeq ORF 2301
Locus ID 5451
Cytogenetics 1q24.2
Domains pou, homeobox
Protein Families Transcription Factors, Druggable Genome
MW 76.3 kDa
Gene Summary The OCT1 transcription factor was among the first identified members of the POU transcription factor family (summarized by Sturm et al., 1993 [PubMed 8314572]). Members of this family contain the POU domain, a 160-amino acid region necessary for DNA binding to the octameric sequence ATGCAAAT.[supplied by OMIM, Jul 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations