COA5 (NM_001008215) Human Tagged ORF Clone

CAT#: RC208299

COA5 (Myc-DDK-tagged)-Human chromosome 2 open reading frame 64 (C2orf64)

Product Images

Circular map for RC208299

• 

  Coomassie blue staining of purified COA5 protein (Cat# TP308299). The protein was produced from HEK293T cells transfected with COA5 cDNA clone (Cat# RC208299) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: COA5
• Synonyms: 6330578E17Rik; C2orf64; CEMCOX3; MC4DN9; Pet191
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC208299 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCTAAGTATTATGAGGACAAGCCGCAGGGCGGCGCGTGCGCGGGCCTGAAGGAGGACCTGGGCGCGT
  GTCTGCTGCAGTCGGACTGTGTGGTCCAGGAAGGAAAATCACCTCGGCAGTGTTTGAAGGAAGGATACTG
  CAACTCTTTGAAGTACGCATTTTTTGAGTGTAAAAGATCAGTGTTGGATAACAGGGCAAGATTCAGAGGA
  AGAAAAGGATAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC208299 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRG
  RKGY
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001008215
• ORF Size: 222 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001008215.3
• RefSeq Size: 1767 bp
• RefSeq ORF: 225 bp
• Locus ID: 493753
• UniProt ID: Q86WW8
• Cytogenetics: 2q11.2
• MW: 8.4 kDa
• Gene Summary: This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011]