Syntaxin 12 (STX12) (NM_177424) Human Tagged ORF Clone

CAT#: RC208282

STX12 (Myc-DDK-tagged)-Human syntaxin 12 (STX12)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_177424" in other vectors (4)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-STX12 Antibody
    • 100 ul

USD 380.00

Other products for "Syntaxin 12"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Syntaxin 12
Synonyms STX13; STX14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208282 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCATACGGTCCCTTAGACATGTACCGGAACCCGGGGCCCTCGGGGCCCCAGCTCCGGGACTTCAGCA
GCATCATCCAGACGTGCAGCGGCAACATCCAGCGGATCAGCCAAGCCACTGCTCAGATAAAGAATTTGAT
GAGCCAGCTAGGAACTAAGCAGGACTCAAGCAAGCTACAGGAAAATCTGCAACAGTTACAACACTCCACA
AATCAGCTCGCCAAGGAAACAAATGAATTGCTGAAAGAATTAGGGTCCTTGCCCCTTCCCTTATCTACTT
CAGAACAGCGCCAGCAGAGACTTCAGAAGGAACGCCTCATGAATGACTTCTCTGCAGCCTTAAACAATTT
CCAGGCTGTGCAGAGAAGGGTATCTGAAAAGGAAAAGGAGAGTATTGCCAGAGCAAGAGCTGGATCTCGT
CTTTCTGCAGAAGAGAGGCAAAGAGAGGAGCAGCTGGTCTCATTTGACAGCCATGAGGAGTGGAACCAGA
TGCAGAGCCAGGAGGATGAGGTGGCCATCACTGAGCAGGATTTGGAACTTATTAAAGAAAGAGAAACGGC
AATTCGGCAGCTGGAGGCTGACATTTTGGATGTCAATCAGATATTTAAAGATTTGGCCATGATGATCCAT
GACCAGGGTGATCTGATTGATAGCATAGAAGCCAATGTGGAAAGCTCAGAGGTGCACGTCGAAAGAGCCA
CTGAACAGTTACAGCGAGCTGCTTACTATCAGAAAAAATCTCGCAAGAAGATGTGTATCCTGGTGCTTGT
CCTGTCAGTGATTATTCTAATCTTGGGACTTATTATCTGGCTAGTTTATAAAACGAAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC208282 protein sequence
Red=Cloning site Green=Tags(s)

MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHST
NQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAVQRRVSEKEKESIARARAGSR
LSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLELIKERETAIRQLEADILDVNQIFKDLAMMIH
DQGDLIDSIEANVESSEVHVERATEQLQRAAYYQKKSRKKMCILVLVLSVIILILGLIIWLVYKTK

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_177424
ORF Size 828 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_177424.3
RefSeq Size 3098 bp
RefSeq ORF 831 bp
Locus ID 23673
UniProt ID Q86Y82
Cytogenetics 1p35.3
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
MW 31.6 kDa
Gene Summary SNARE that acts to regulate protein transport between late endosomes and the trans-Golgi network. The SNARE complex containing STX6, STX12, VAMP4 and VTI1A mediates vesicle fusion (in vitro) (By similarity). Through complex formation with GRIP1, GRIA2 and NSG1 controls the intracellular fate of AMPAR and the endosomal sorting of the GRIA2 subunit toward recycling and membrane targeting (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.