RALA (NM_005402) Human Tagged ORF Clone

CAT#: RC208076

RALA (Myc-DDK-tagged)-Human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)

Product Images

Circular map for RC208076

• 

  Western blot validation of overexpression lysate (Cat# LY417324) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC208076 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified RALA protein (Cat# TP308076). The protein was produced from HEK293T cells transfected with RALA cDNA clone (Cat# RC208076) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RALA
• Synonyms: HINCONS; RAL
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC208076 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGCAAATAAGCCCAAGGGTCAGAATTCTTTGGCTTTACACAAAGTCATCATGGTGGGCAGTGGTG
  GCGTGGGCAAGTCAGCTCTGACTCTACAGTTCATGTACGATGAGTTTGTGGAGGACTATGAGCCTACCAA
  AGCAGACAGCTATCGGAAGAAGGTAGTGCTAGATGGGGAGGAAGTCCAGATCGATATCTTAGATACAGCT
  GGGCAGGAGGACTACGCTGCAATTAGAGACAACTACTTCCGAAGTGGGGAGGGGTTCCTCTGTGTTTTCT
  CTATTACAGAAATGGAATCCTTTGCAGCTACAGCTGACTTCAGGGAGCAGATTTTAAGAGTAAAAGAAGA
  TGAGAATGTTCCATTTCTACTGGTTGGTAACAAATCAGATTTAGAAGATAAAAGACAGGTTTCTGTAGAA
  GAGGCAAAAAACAGAGCTGAGCAGTGGAATGTTAACTACGTGGAAACATCTGCTAAAACACGAGCTAATG
  TTGACAAGGTATTTTTTGATTTAATGAGAGAAATTCGAGCGAGAAAGATGGAAGACAGCAAAGAAAAGAA
  TGGAAAAAAGAAGAGGAAAAGTTTAGCCAAGAGAATCAGAGAAAGATGCTGCATTTTA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC208076 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
  GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE
  EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005402
• ORF Size: 618 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005402.4
• RefSeq Size: 2828 bp
• RefSeq ORF: 621 bp
• Locus ID: 5898
• UniProt ID: P11233
• Cytogenetics: 7p14.1
• Domains: ras, RAN, RAS, RHO, RAB
• Protein Families: Druggable Genome
• Protein Pathways: Pancreatic cancer, Pathways in cancer
• MW: 23.6 kDa
• Gene Summary: The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008]