HSPA6 (NM_002155) Human Tagged ORF Clone

CAT#: RC207795

Reviews ()
Write a review

HSPA6 (Myc-DDK-tagged)-Human heat shock 70kDa protein 6 (HSP70B') (HSPA6)



  "NM_002155" in other vectors (4)

Reconstitution Protocol

USD 897.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "HSPA6"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HSPA6
Synonyms HSP70B'
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207795 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCCCCACGGGAGCTCGCGGTGGGCATCGACCTGGGCACCACCTACTCGTGCGTGGGCGTGTTTC
AGCAGGGCCGCGTGGAGATCCTGGCCAACGACCAGGGCAACCGCACCACGCCCAGCTACGTGGCCTTCAC
CGACACCGAGCGGCTGGTCGGGGACGCGGCCAAGAGCCAGGCGGCCCTGAACCCCCACAACACCGTGTTC
GATGCCAAGCGGCTGATCGGGCGCAAGTTCGCGGACACCACGGTGCAGTCGGACATGAAGCACTGGCCCT
TCCGGGTGGTGAGCGAGGGCGGCAAGCCCAAGGTGCGCGTATGCTACCGCGGGGAGGACAAGACGTTCTA
CCCCGAGGAGATCTCGTCCATGGTGCTGAGCAAGATGAAGGAGACGGCCGAGGCGTACCTGGGCCAGCCC
GTGAAGCACGCAGTGATCACCGTGCCCGCCTATTTCAATGACTCGCAGCGCCAGGCCACCAAGGACGCGG
GGGCCATCGCGGGGCTCAACGTGTTGCGGATCATCAATGAGCCCACGGCAGCTGCCATCGCCTATGGGCT
GGACCGGCGGGGCGCGGGAGAGCGCAACGTGCTCATTTTTGACCTGGGTGGGGGCACCTTCGATGTGTCG
GTTCTCTCCATTGACGCTGGTGTCTTTGAGGTGAAAGCCACTGCTGGAGATACCCACCTGGGAGGAGAGG
ACTTCGACAACCGGCTCGTGAACCACTTCATGGAAGAATTCCGGCGGAAGCATGGGAAGGACCTGAGCGG
GAACAAGCGTGCCCTGCGCAGGCTGCGCACAGCCTGTGAGCGCGCCAAGCGCACCCTGTCCTCCAGCACC
CAGGCCACCCTGGAGATAGACTCCCTGTTCGAGGGCGTGGACTTCTACACGTCCATCACTCGTGCCCGCT
TTGAGGAACTGTGCTCAGACCTCTTCCGCAGCACCCTGGAGCCGGTGGAGAAGGCCCTGCGGGATGCCAA
GCTGGACAAGGCCCAGATTCATGACGTCGTCCTGGTGGGGGGCTCCACTCGCATCCCCAAGGTGCAGAAG
TTGCTGCAGGACTTCTTCAACGGCAAGGAGCTGAACAAGAGCATCAACCCTGATGAGGCTGTGGCCTATG
GGGCTGCTGTGCAGGCGGCCGTGTTGATGGGGGACAAATGTGAGAAAGTGCAGGATCTCCTGCTGCTGGA
TGTGGCTCCCCTGTCTCTGGGGCTGGAGACAGCAGGTGGGGTGATGACCACGCTGATCCAGAGGAACGCC
ACTATCCCCACCAAGCAGACCCAGACTTTCACCACCTACTCGGACAACCAGCCTGGGGTCTTCATCCAGG
TGTATGAGGGTGAGAGGGCCATGACCAAGGACAACAACCTGCTGGGGCGTTTTGAACTCAGTGGCATCCC
TCCTGCCCCACGTGGAGTCCCCCAGATAGAGGTGACCTTTGACATTGATGCTAATGGCATCCTGAGCGTG
ACAGCCACTGACAGGAGCACAGGTAAGGCTAACAAGATCACCATCACCAATGACAAGGGCCGGCTGAGCA
AGGAGGAGGTGGAGAGGATGGTTCATGAAGCCGAGCAGTACAAGGCTGAGGATGAGGCCCAGAGGGACAG
AGTGGCTGCCAAAAACTCGCTGGAGGCCCATGTCTTCCATGTGAAAGGTTCTTTGCAAGAGGAAAGCCTT
AGGGACAAGATTCCCGAAGAGGACAGGCGCAAAATGCAAGACAAGTGTCGGGAAGTCCTTGCCTGGCTGG
AGCACAACCAGCTGGCAGAGAAGGAGGAGTATGAGCATCAGAAGAGGGAGCTGGAGCAAATCTGTCGCCC
CATCTTCTCCAGGCTCTATGGGGGGCCTGGTGTCCCTGGGGGCAGCAGTTGTGGCACTCAAGCCCGCCAG
GGGGACCCCAGCACCGGCCCCATCATTGAGGAGGTTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207795 protein sequence
Red=Cloning site Green=Tags(s)

MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPHNTVF
DAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQP
VKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDVS
VLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSST
QATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQK
LLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSV
TATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESL
RDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQ
GDPSTGPIIEEVD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002155
ORF Size 1929 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002155.3, NP_002146.2
RefSeq Size 2664 bp
RefSeq ORF 1932 bp
Locus ID 3310
UniProt ID P17066
Cytogenetics 1q23.3
Domains HSP70
Protein Pathways Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Spliceosome
MW 71 kDa
Gene Summary Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release (PubMed:26865365).[UniProtKB/Swiss-Prot Function]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.