CDC25B (NM_021873) Human Tagged ORF Clone

CAT#: RC207409

CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CDC25B (NM_021873) Human Tagged ORF Clone
Symbol CDC25B
Synonyms OTTHUMP00000030137; OTTHUMP00000030138; OTTHUMP00000030139; cell division cycle 25B; cell division cycle 25 homolog B (S. pombe)
Vector pCMV6-Entry
Sequence Data
>RC207409 representing NM_021873
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGCCCCAGCCGGAGCCCGCGCCAGGCTCGGCTCTCAGTCCAGCAGGCGTGTGCGGTGGCGCCC
AGCGTCCGGGCCACCTCCCGGGCCTCCTGCTGGGATCTCATGGCCTCCTGGGGTCCCCGGTGCGGGCGGC
CGCTTCCTCGCCGGTCACCACCCTCACCCAGACCATGCACGACCTCGCCGGGCTCGGCAGCGAAACCCCA
AAGAGTCAGGTAGGGACCCTGCTCTTCCGCAGCCGCAGCCGCCTGACGCACCTATCCCTGTCTCGACGGG
CATCCGAATCCTCCCTGTCGTCTGAATCCTCCGAATCTTCTGATGCAGGTCTCTGCATGGATTCCCCCAG
CCCTATGGACCCCCACATGGCGGAGCAGACGTTTGAACAGGCCATCCAGGCAGCCAGCCGGATCATTCGA
AACGAGCAGTTTGCCATCAGACGCTTCCAGTCTATGCCGGTGAGGCTGCTGGGCCACAGCCCCGTGCTTC
GGAACATCACCAACTCCCAGGCGCCCGACGGCCGGAGGAAGAGCGAGGCGGGCAGTGGAGCTGCCAGCAG
CTCTGGGGAAGACAAGGAGAATGATGGATTTGTCTTCAAGATGCCATGGAAGCCCACACATCCCAGCTCC
ACCCATGCTCTGGCAGAGTGGGCCAGCCGCAGGGAAGCCTTTGCCCAGAGACCCAGCTCGGCCCCCGACC
TGATGTGTCTCAGTCCTGACCGGAAGATGGAAGTGGAGGAGCTCAGCCCCCTGGCCCTAGGTCGCTTCTC
TCTGACCCCTGCAGAGGGGGATACTGAGGAAGATGATGGATTTGTGGACATCCTAGAGAGTGACTTAAAG
GATGATGATGCAGTTCCCCCAGGCATGGAGAGTCTCATTAGTGCCCCACTGGTCAAGACCTTGGAAAAGG
AAGAGGAAAAGGACCTCGTCATGTACAGCAAGTGCCAGCGGCTCTTCCGCTCTCCGTCCATGCCCTGCAG
CGTGATCCGGCCCATCCTCAAGAGGCTGGAGCGGCCCCAGGACAGGGACACGCCCGTGCAGAATAAGCGG
AGGCGGAGCGTGACCCCTCCTGAGGAGCAGCAGGAGGCTGAGGAACCTAAAGCCCGCGTCCTCCGCTCAA
AATCACTGTGTCACGATGAGATCGAGAACCTCCTGGACAGTGACCACCGAGAGCTGATTGGAGATTACTC
TAAGGCCTTCCTCCTACAGACAGTAGACGGAAAGCACCAAGACCTCAAGTACATCTCACCAGAAACGATG
GTGGCCCTATTGACGGGCAAGTTCAGCAACATCGTGGATAAGTTTGTGATTGTAGACTGCAGATACCCCT
ATGAATATGAAGGCGGGCACATCAAGACTGCGGTGAACTTGCCCCTGGAACGCGACGCCGAGAGCTTCCT
ACTGAAGAGCCCCATCGCGCCCTGTAGCCTGGACAAGAGAGTCATCCTCATTTTCCACTGTGAATTCTCA
TCTGAGCGTGGGCCCCGCATGTGCCGTTTCATCAGGGAACGAGACCGTGCTGTCAACGACTACCCCAGCC
TCTACTACCCTGAGATGTATATCCTGAAAGGCGGCTACAAGGAGTTCTTCCCTCAGCACCCGAACTTCTG
TGAACCCCAGGACTACCGGCCCATGAACCACGAGGCCTTCAAGGATGAGCTAAAGACCTTCCGCCTCAAG
ACTCGCAGCTGGGCTGGGGAGCGGAGCCGGCGGGAGCTCTGTAGCCGGCTGCAGGACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207409 representing NM_021873
Red=Cloning site Green=Tags(s)

MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETP
KSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIR
NEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSS
THALAEWASRREAFAQRPSSAPDLMCLSPDRKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLK
DDDAVPPGMESLISAPLVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKR
RRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFS
SERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLK
TRSWAGERSRRELCSRLQDQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021873
ORF Size 1740 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021873.1, NM_021873.2, NM_021873.3, NP_068659
RefSeq Size 3701
RefSeq ORF 1743
Locus ID 994
Cytogenetics 20p13
Domains RHOD
Protein Families Phosphatase, Druggable Genome
Protein Pathways MAPK signaling pathway, Cell cycle, Progesterone-mediated oocyte maturation
MW 64.8 kDa
Gene Summary CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)