CDC25B (NM_021873) Human Tagged ORF Clone

CAT#: RC207409

Reviews ()
Write a review

CDC25B (Myc-DDK-tagged)-Human cell division cycle 25 homolog B (S. pombe) (CDC25B), transcript variant 1



  "NM_021873" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CDC25B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207409 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGCCCCAGCCGGAGCCCGCGCCAGGCTCGGCTCTCAGTCCAGCAGGCGTGTGCGGTGGCGCCC
AGCGTCCGGGCCACCTCCCGGGCCTCCTGCTGGGATCTCATGGCCTCCTGGGGTCCCCGGTGCGGGCGGC
CGCTTCCTCGCCGGTCACCACCCTCACCCAGACCATGCACGACCTCGCCGGGCTCGGCAGCGAAACCCCA
AAGAGTCAGGTAGGGACCCTGCTCTTCCGCAGCCGCAGCCGCCTGACGCACCTATCCCTGTCTCGACGGG
CATCCGAATCCTCCCTGTCGTCTGAATCCTCCGAATCTTCTGATGCAGGTCTCTGCATGGATTCCCCCAG
CCCTATGGACCCCCACATGGCGGAGCAGACGTTTGAACAGGCCATCCAGGCAGCCAGCCGGATCATTCGA
AACGAGCAGTTTGCCATCAGACGCTTCCAGTCTATGCCGGTGAGGCTGCTGGGCCACAGCCCCGTGCTTC
GGAACATCACCAACTCCCAGGCGCCCGACGGCCGGAGGAAGAGCGAGGCGGGCAGTGGAGCTGCCAGCAG
CTCTGGGGAAGACAAGGAGAATGATGGATTTGTCTTCAAGATGCCATGGAAGCCCACACATCCCAGCTCC
ACCCATGCTCTGGCAGAGTGGGCCAGCCGCAGGGAAGCCTTTGCCCAGAGACCCAGCTCGGCCCCCGACC
TGATGTGTCTCAGTCCTGACCGGAAGATGGAAGTGGAGGAGCTCAGCCCCCTGGCCCTAGGTCGCTTCTC
TCTGACCCCTGCAGAGGGGGATACTGAGGAAGATGATGGATTTGTGGACATCCTAGAGAGTGACTTAAAG
GATGATGATGCAGTTCCCCCAGGCATGGAGAGTCTCATTAGTGCCCCACTGGTCAAGACCTTGGAAAAGG
AAGAGGAAAAGGACCTCGTCATGTACAGCAAGTGCCAGCGGCTCTTCCGCTCTCCGTCCATGCCCTGCAG
CGTGATCCGGCCCATCCTCAAGAGGCTGGAGCGGCCCCAGGACAGGGACACGCCCGTGCAGAATAAGCGG
AGGCGGAGCGTGACCCCTCCTGAGGAGCAGCAGGAGGCTGAGGAACCTAAAGCCCGCGTCCTCCGCTCAA
AATCACTGTGTCACGATGAGATCGAGAACCTCCTGGACAGTGACCACCGAGAGCTGATTGGAGATTACTC
TAAGGCCTTCCTCCTACAGACAGTAGACGGAAAGCACCAAGACCTCAAGTACATCTCACCAGAAACGATG
GTGGCCCTATTGACGGGCAAGTTCAGCAACATCGTGGATAAGTTTGTGATTGTAGACTGCAGATACCCCT
ATGAATATGAAGGCGGGCACATCAAGACTGCGGTGAACTTGCCCCTGGAACGCGACGCCGAGAGCTTCCT
ACTGAAGAGCCCCATCGCGCCCTGTAGCCTGGACAAGAGAGTCATCCTCATTTTCCACTGTGAATTCTCA
TCTGAGCGTGGGCCCCGCATGTGCCGTTTCATCAGGGAACGAGACCGTGCTGTCAACGACTACCCCAGCC
TCTACTACCCTGAGATGTATATCCTGAAAGGCGGCTACAAGGAGTTCTTCCCTCAGCACCCGAACTTCTG
TGAACCCCAGGACTACCGGCCCATGAACCACGAGGCCTTCAAGGATGAGCTAAAGACCTTCCGCCTCAAG
ACTCGCAGCTGGGCTGGGGAGCGGAGCCGGCGGGAGCTCTGTAGCCGGCTGCAGGACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207409 protein sequence
Red=Cloning site Green=Tags(s)

MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETP
KSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIR
NEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSS
THALAEWASRREAFAQRPSSAPDLMCLSPDRKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLK
DDDAVPPGMESLISAPLVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKR
RRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFS
SERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLK
TRSWAGERSRRELCSRLQDQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021873
ORF Size 1740 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021873.3
RefSeq Size 3696 bp
RefSeq ORF 1743 bp
Locus ID 994
UniProt ID P30305
Cytogenetics 20p13
Domains RHOD
Protein Families Druggable Genome, Phosphatase
Protein Pathways Cell cycle, MAPK signaling pathway, Progesterone-mediated oocyte maturation
MW 65 kDa
Gene Summary CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "CDC25B"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.