DARS2 (NM_018122) Human Tagged ORF Clone

CAT#: RC207360

Reviews ()
Write a review

DARS2 (Myc-DDK-tagged)-Human aspartyl-tRNA synthetase 2, mitochondrial (DARS2), nuclear gene encoding mitochondrial protein



  "NM_018122" in other vectors (7)

USD 480.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DARS2 (NM_018122) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DARS2
Synonyms ASPRS; LBSL; MT-ASPRS; mtAspRS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC207360 representing NM_018122
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACTTCCCTTCTTGGTTAAGTCAGCTGTACAGGGGTTTATCCAGACCCATCAGAAGGACCACCCAAC
CGATCTGGGGTTCTCTCTACAGAAGTCTGTTGCAGAGTTCACAGAGGAGAATTCCAGAATTCAGTAGCTT
TGTTGTCCGGACCAACACATGTGGAGAGTTGCGTTCGTCTCACTTAGGCCAAGAAGTCACCTTGTGTGGA
TGGATTCAGTACCGAAGGCAAAACACATTCTTGGTCCTAAGAGATTTCGATGGGCTTGTTCAAGTTATCA
TTCCCCAGGATGAGTCGGCAGCCTCTGTGAAGAAGATTTTATGTGAAGCCCCTGTGGAATCTGTGGTGCA
AGTGTCTGGTACAGTCATTTCCCGTCCTGCAGGACAAGAGAATCCAAAAATGCCAACAGGTGAGATTGAA
ATCAAAGTTAAAACAGCTGAGCTTCTGAATGCCTGCAAGAAGCTGCCCTTTGAAATTAAGAACTTCGTGA
AGAAAACAGAGGCTCTTCGGTTGCAGTATCGCTACTTAGACTTGCGTAGTTTCCAAATGCAGTATAACCT
GCGACTGAGGTCCCAGATGGTCATGAAAATGCGGGAATATCTCTGTAATCTGCATGGGTTTGTGGATATA
GAAACCCCCACATTGTTTAAGAGGACCCCAGGGGGTGCCAAAGAGTTTTTAGTACCATCCAGGGAACCTG
GAAAGTTTTATTCTCTCCCTCAGAGTCCTCAACAGTTTAAGCAACTTCTGATGGTTGGCGGTTTAGACAG
ATATTTTCAGGTTGCCCGATGTTATCGAGATGAAGGTTCAAGACCAGACAGACAGCCTGAGTTTACTCAG
ATTGACATAGAGATGTCATTTGTAGACCAGACTGGGATCCAGAGTTTAATTGAGGGTTTGCTCCAGTATT
CCTGGCCCAATGACAAAGATCCTGTGGTTGTTCCTTTTCCTACTATGACTTTTGCTGAGGTGCTGGCCAC
CTATGGAACTGATAAACCTGACACTCGCTTTGGAATGAAGATTATAGATATCAGTGATGTGTTTAGAAAC
ACAGAGATTGGATTTCTTCAAGATGCACTTAGTAAGCCCCATGGAACTGTGAAAGCCATATGTATCCCTG
AAGGAGCAAAATACTTAAAAAGGAAAGACATTGAATCCATTAGAAACTTTGCAGCTGACCATTTTAATCA
GGAAATCTTACCTGTATTCCTTAACGCCAATAGAAACTGGAATTCTCCAGTTGCTAATTTCATAATGGAG
TCACAAAGACTGGAATTAATCAGACTAATGGAGACCCAAGAGGAAGATGTGGTCCTACTAACTGCTGGAG
AGCACAATAAAGCATGCTCTTTGTTAGGAAAATTACGACTGGAATGTGCTGACCTTCTAGAAACAAGAGG
AGTGGTGCTCCGTGACCCCACTCTGTTCTCTTTCCTTTGGGTGGTAGATTTCCCACTCTTCCTGCCCAAG
GAGGAAAATCCCAGAGAGCTGGAATCGGCCCACCACCCATTTACTGCTCCCCACCCCAGTGACATACATC
TCCTGTACACTGAGCCCAAAAAGGCCCGTAGCCAACACTATGACTTGGTTTTAAATGGCAATGAAATAGG
AGGTGGTTCAATTCGAATTCACAATGCAGAGCTGCAGCGTTATATCCTGGCAACCTTACTAAAGGAGGAT
GTGAAAATGCTCTCCCATCTGCTCCAGGCTTTAGATTATGGGGCACCCCCTCATGGAGGAATTGCCTTAG
GGTTAGACAGACTGATATGCCTTGTCACTGGATCTCCAAGCATCAGAGATGTCATAGCCTTCCCAAAGTC
CTTCCGGGGACATGACCTCATGAGCAATACCCCAGATTCTGTCCCTCCTGAGGAACTGAAGCCCTATCAT
ATCCGAGTCTCCAAGCCAACAGACTCCAAAGCAGAAAGAGCTCAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207360 representing NM_018122
Red=Cloning site Green=Tags(s)

MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCG
WIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIE
IKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDI
ETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQ
IDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRN
TEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIME
SQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPK
EENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKED
VKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYH
IRVSKPTDSKAERAH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018122
ORF Size 1935 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018122.2, NM_018122.3, NM_018122.4, NP_060592.2
RefSeq Size 3187 bp
RefSeq ORF 1938 bp
Locus ID 55157
Cytogenetics 1q25.1
Domains GAD, tRNA-synt_2
Protein Pathways Aminoacyl-tRNA biosynthesis
MW 73.4 kDa
Gene Summary The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. It is a mitochondrial enzyme that specifically aminoacylates aspartyl-tRNA. Mutations in this gene are associated with leukoencephalopathy with brainstem and spinal cord involvement and lactate elevation (LBSL). [provided by RefSeq, Nov 2009]

Other Versions

Other products for "DARS2"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools