SFRP1 (NM_003012) Human Tagged ORF Clone

CAT#: RC207328

SFRP1 (Myc-DDK-tagged)-Human secreted frizzled-related protein 1 (SFRP1)

Change vector?

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name SFRP1 (NM_003012) Human Tagged ORF Clone
Symbol SFRP1
Synonyms FRP; FRP-1; FRP1; FrzA; SARP2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207328 representing NM_003012
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCATCGGGCGCAGCGAGGGGGGCCGCCGCGGGGCAGCCCTGGGCGTGCTGCTGGCGCTGGGCGCGG
CGCTTCTGGCCGTGGGCTCGGCCAGCGAGTACGACTACGTGAGCTTCCAGTCGGACATCGGCCCGTACCA
GAGCGGGCGCTTCTACACCAAGCCACCTCAGTGCGTGGACATCCCCGCGGACCTGCGGCTGTGCCACAAC
GTGGGCTACAAGAAGATGGTGCTGCCCAACCTGCTGGAGCACGAGACCATGGCGGAGGTGAAGCAGCAGG
CCAGCAGCTGGGTGCCCCTGCTCAACAAGAACTGCCACGCCGGCACCCAGGTCTTCCTCTGCTCGCTCTT
CGCGCCCGTCTGCCTGGACCGGCCCATCTACCCGTGTCGCTGGCTCTGCGAGGCCGTGCGCGACTCGTGC
GAGCCGGTCATGCAGTTCTTCGGCTTCTACTGGCCCGAGATGCTTAAGTGTGACAAGTTCCCCGAGGGGG
ACGTCTGCATCGCCATGACGCCGCCCAATGCCACCGAAGCCTCCAAGCCCCAAGGCACAACGGTGTGTCC
TCCCTGTGACAACGAGTTGAAATCTGAGGCCATCATTGAACATCTCTGTGCCAGCGAGTTTGCACTGAGG
ATGAAAATAAAAGAAGTGAAAAAAGAAAATGGCGACAAGAAGATTGTCCCCAAGAAGAAGAAGCCCCTGA
AGTTGGGGCCCATCAAGAAGAAGGACCTGAAGAAGCTTGTGCTGTACCTGAAGAATGGGGCTGACTGTCC
CTGCCACCAGCTGGACAACCTCAGCCACCACTTCCTCATCATGGGCCGCAAGGTGAAGAGCCAGTACTTG
CTGACGGCCATCCACAAGTGGGACAAGAAAAACAAGGAGTTCAAAAACTTCATGAAGAAAATGAAAAACC
ATGAGTGCCCCACCTTTCAGTCCGTGTTTAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207328 representing NM_003012
Red=Cloning site Green=Tags(s)

MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHN
VGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSC
EPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALR
MKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYL
LTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003012
ORF Size 942 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003012.1, NM_003012.2, NM_003012.3, NM_003012.4, NP_003003
RefSeq Size 4465
Locus ID 6422
Cytogenetics 8p11.21
Domains FRI, C345C
Protein Families Stem cell relevant signaling - Wnt Signaling pathway, Secreted Protein, ES Cell Differentiation/IPS, Transmembrane, Adult stem cells, Cancer stem cells, Druggable Genome
Protein Pathways Wnt signaling pathway
MW 35.2 kDa
Gene Summary This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina. [provided by RefSeq, Sep 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations