FIG4 (NM_014845) Human Tagged ORF Clone

CAT#: RC207192

Reviews ()
Write a review

FIG4 (Myc-DDK-tagged)-Human FIG4 homolog, SAC1 lipid phosphatase domain containing (S. cerevisiae) (FIG4)



  "NM_014845" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FIG4
Synonyms ALS11; BTOP; CMT4J; dJ249I4.1; KIAA0274; SAC3; YVS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207192 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCACGGCCGCCGCCCCCATCATCAGCTCGGTCCAGAAGCTGGTTCTGTATGAGACTAGAGCTAGAT
ACTTTCTAGTTGGGAGCAATAATGCAGAAACGAAATATCGTGTCTTGAAGATTGATAGAACAGAACCAAA
AGATTTGGTCATAATTGATGACAGGCATGTCTATACTCAACAAGAAGTAAGGGAACTTCTTGGCCGCTTG
GATCTTGGAAATAGAACAAAGATGGGACAGAAAGGATCCTCGGGCTTATTTCGAGCGGTTTCAGCTTTTG
GTGTTGTGGGTTTTGTCAGGTTCTTAGAAGGCTATTATATTGTGTTAATAACTAAAAGGAGGAAGATGGC
GGATATTGGAGGTCATGCAATCTATAAGGTCGAAGATACAAATATGATCTATATACCCAATGATTCTGTA
CGGGTTACTCATCCTGATGAAGCTAGGTATCTACGAATATTTCAAAATGTGGACCTATCTAGCAATTTTT
ACTTTAGTTACAGCTATGATTTGTCCCACTCACTTCAATATAATCTCACTGTCTTGCGAATGCCCCTGGA
GATGTTAAAGTCAGAAATGACCCAGAATCGCCAAGAGAGCTTTGACATCTTTGAAGATGAAGGATTAATT
ACACAAGGTGGAAGCGGGGTATTTGGGATCTGTAGTGAGCCTTATATGAAATATGTATGGAATGGTGAAC
TTCTGGATATAATTAAAAGTACTGTGCATCGTGACTGGCTTTTGTATATTATTCATGGGTTCTGTGGGCA
GTCAAAGCTGTTGATCTATGGACGACCAGTGTATGTCACTCTAATAGCTAGAAGATCCAGTAAATTTGCT
GGCACCCGTTTTCTTAAAAGAGGTGCAAACTGTGAGGGTGATGTTGCAAATGAAGTGGAGACTGAACAAA
TACTCTGCGATGCTTCTGTGATGTCTTTCACTGCAGGAAGTTATTCTTCATATGTACAAGTTAGAGGATC
TGTGCCCTTATACTGGTCTCAGGACATTTCAACTATGATGCCTAAACCACCTATTACATTGGATCAGGCA
GATCCATTTGCACATGTGGCTGCCCTTCACTTTGACCAGATGTTCCAGAGGTTTGGCTCTCCCATCATCA
TCTTGAATTTAGTGAAGGAACGAGAGAAAAGAAAGCATGAAAGAATTCTGAGTGAAGAACTTGTTGCTGC
TGTGACCTATCTCAACCAATTTTTGCCTCCTGAGCACACTATTGTTTATATTCCCTGGGACATGGCCAAG
TATACCAAAAGCAAGCTGTGTAATGTTCTTGATCGACTAAATGTGATTGCAGAAAGTGTGGTGAAGAAAA
CAGGTTTCTTTGTAAACCGCCCTGATTCTTACTGTAGCATTTTGCGGCCAGATGAAAAGTGGAATGAACT
AGGAGGATGTGTGATTCCCACTGGTCGCCTGCAGACTGGCATCCTTCGAACCAACTGTGTGGACTGTTTA
GATCGCACCAACACAGCACAGTTTATGGTGGGAAAATGTGCTCTGGCCTATCAGCTGTATTCACTGGGAC
TGATTGACAAACCTAATCTACAGTTTGATACAGATGCAGTTAGGTTATTTGAGGAACTCTATGAAGATCA
TGGTGATACCCTATCCCTTCAGTATGGTGGTTCTCAACTTGTTCATCGTGTGAAAACCTACAGAAAGATA
GCACCATGGACCCAGCACTCCAAAGACATCATGCAAACCCTGTCTAGATATTACAGCAATGCTTTTTCAG
ATGCCGATAGACAAGATTCCATTAATCTCTTCCTGGGAGTTTTCCATCCCACTGAAGGGAAACCTCATCT
CTGGGAGCTCCCAACAGATTTTTATTTGCATCACAAAAATACCATGAGACTTTTGCCAACAAGAAGAAGT
TATACTTACTGGTGGACACCAGAGGTGATAAAGCATTTACCATTGCCCTATGATGAAGTTATCTGTGCTG
TGAACTTAAAGAAGTTGATAGTGAAGAAATTCCACAAATATGAAGAAGAGATTGATATCCACAATGAGTT
CTTTCGGCCATATGAGTTGAGCAGCTTTGATGATACCTTTTGCTTGGCTATGACAAGCTCAGCACGTGAC
TTTATGCCTAAGACCGTTGGAATTGATCCAAGTCCATTTACTGTGCGTAAACCAGATGAAACTGGAAAAT
CAGTATTGGGAAACAAAAGCAATAGAGAAGAAGCTGTATTACAGCGGAAAACGGCAGCCAGCGCCCCGCC
GCCACCCAGCGAGGAGGCTGTGTCCAGCAGCTCTGAGGATGACTCTGGGACTGATCGGGAAGAAGAGGGC
TCTGTGTCTCAGCGCTCCACTCCCGTGAAGATGACTGATGCAGGAGACAGTGCCAAAGTGACCGAGAATG
TGGTCCAACCCATGAAGGAGCTATATGGAATTAACCTCTCAGATGGCCTCTCAGAAGAAGATTTCTCCAT
TTATTCAAGATTTGTTCAGCTGGGGCAGAGTCAACATAAACAAGACAAGAATAGCCAGCAGCCCTGTTCT
AGGTGCTCAGATGGAGTTATAAAACTAACACCCATCTCGGCTTTCTCGCAAGATAACATCTATGAAGTTC
AGCCCCCAAGAGTAGACAGAAAATCTACAGAGATCTTCCAAGCCCACATCCAGGCCAGCCAAGGTATCAT
GCAGCCCCTAGGAAAAGAGGACTCCTCCATGTACCGAGAGTACATCAGGAACCGCTACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207192 protein sequence
Red=Cloning site Green=Tags(s)

MPTAAAPIISSVQKLVLYETRARYFLVGSNNAETKYRVLKIDRTEPKDLVIIDDRHVYTQQEVRELLGRL
DLGNRTKMGQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIGGHAIYKVEDTNMIYIPNDSV
RVTHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSEMTQNRQESFDIFEDEGLI
TQGGSGVFGICSEPYMKYVWNGELLDIIKSTVHRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSKFA
GTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQA
DPFAHVAALHFDQMFQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLNQFLPPEHTIVYIPWDMAK
YTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGCVIPTGRLQTGILRTNCVDCL
DRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKI
APWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPHLWELPTDFYLHHKNTMRLLPTRRS
YTYWWTPEVIKHLPLPYDEVICAVNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARD
FMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEG
SVSQRSTPVKMTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCS
RCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYREYIRNRYL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014845
ORF Size 2721 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014845.3
RefSeq Size 3123 bp
RefSeq ORF 2724 bp
Locus ID 9896
UniProt ID Q92562
Cytogenetics 6q21
Domains Syja_N
MW 103.6 kDa
Gene Summary The protein encoded by this gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. The yeast homolog, Sac1p, is involved in the regulation of various phosphoinositides, and affects diverse cellular functions such as actin cytoskeleton organization, Golgi function, and maintenance of vacuole morphology. Membrane-bound phosphoinositides function as signaling molecules and play a key role in vesicle trafficking in eukaryotic cells. Mutations in this gene have been associated with Charcot-Marie-Tooth disease, type 4J. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "FIG4"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal FIG4 Antibody
    • 100 ug

USD 450.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.