FIG4 (NM_014845) Human Tagged ORF Clone

CAT#: RC207192

FIG4 (Myc-DDK-tagged)-Human FIG4 homolog, SAC1 lipid phosphatase domain containing (S. cerevisiae) (FIG4)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FIG4 (NM_014845) Human Tagged ORF Clone
Symbol FIG4
Synonyms ALS11; BTOP; CMT4J; dJ249I4.1; KIAA0274; SAC3; YVS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207192 representing NM_014845
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCACGGCCGCCGCCCCCATCATCAGCTCGGTCCAGAAGCTGGTTCTGTATGAGACTAGAGCTAGAT
ACTTTCTAGTTGGGAGCAATAATGCAGAAACGAAATATCGTGTCTTGAAGATTGATAGAACAGAACCAAA
AGATTTGGTCATAATTGATGACAGGCATGTCTATACTCAACAAGAAGTAAGGGAACTTCTTGGCCGCTTG
GATCTTGGAAATAGAACAAAGATGGGACAGAAAGGATCCTCGGGCTTATTTCGAGCGGTTTCAGCTTTTG
GTGTTGTGGGTTTTGTCAGGTTCTTAGAAGGCTATTATATTGTGTTAATAACTAAAAGGAGGAAGATGGC
GGATATTGGAGGTCATGCAATCTATAAGGTCGAAGATACAAATATGATCTATATACCCAATGATTCTGTA
CGGGTTACTCATCCTGATGAAGCTAGGTATCTACGAATATTTCAAAATGTGGACCTATCTAGCAATTTTT
ACTTTAGTTACAGCTATGATTTGTCCCACTCACTTCAATATAATCTCACTGTCTTGCGAATGCCCCTGGA
GATGTTAAAGTCAGAAATGACCCAGAATCGCCAAGAGAGCTTTGACATCTTTGAAGATGAAGGATTAATT
ACACAAGGTGGAAGCGGGGTATTTGGGATCTGTAGTGAGCCTTATATGAAATATGTATGGAATGGTGAAC
TTCTGGATATAATTAAAAGTACTGTGCATCGTGACTGGCTTTTGTATATTATTCATGGGTTCTGTGGGCA
GTCAAAGCTGTTGATCTATGGACGACCAGTGTATGTCACTCTAATAGCTAGAAGATCCAGTAAATTTGCT
GGCACCCGTTTTCTTAAAAGAGGTGCAAACTGTGAGGGTGATGTTGCAAATGAAGTGGAGACTGAACAAA
TACTCTGCGATGCTTCTGTGATGTCTTTCACTGCAGGAAGTTATTCTTCATATGTACAAGTTAGAGGATC
TGTGCCCTTATACTGGTCTCAGGACATTTCAACTATGATGCCTAAACCACCTATTACATTGGATCAGGCA
GATCCATTTGCACATGTGGCTGCCCTTCACTTTGACCAGATGTTCCAGAGGTTTGGCTCTCCCATCATCA
TCTTGAATTTAGTGAAGGAACGAGAGAAAAGAAAGCATGAAAGAATTCTGAGTGAAGAACTTGTTGCTGC
TGTGACCTATCTCAACCAATTTTTGCCTCCTGAGCACACTATTGTTTATATTCCCTGGGACATGGCCAAG
TATACCAAAAGCAAGCTGTGTAATGTTCTTGATCGACTAAATGTGATTGCAGAAAGTGTGGTGAAGAAAA
CAGGTTTCTTTGTAAACCGCCCTGATTCTTACTGTAGCATTTTGCGGCCAGATGAAAAGTGGAATGAACT
AGGAGGATGTGTGATTCCCACTGGTCGCCTGCAGACTGGCATCCTTCGAACCAACTGTGTGGACTGTTTA
GATCGCACCAACACAGCACAGTTTATGGTGGGAAAATGTGCTCTGGCCTATCAGCTGTATTCACTGGGAC
TGATTGACAAACCTAATCTACAGTTTGATACAGATGCAGTTAGGTTATTTGAGGAACTCTATGAAGATCA
TGGTGATACCCTATCCCTTCAGTATGGTGGTTCTCAACTTGTTCATCGTGTGAAAACCTACAGAAAGATA
GCACCATGGACCCAGCACTCCAAAGACATCATGCAAACCCTGTCTAGATATTACAGCAATGCTTTTTCAG
ATGCCGATAGACAAGATTCCATTAATCTCTTCCTGGGAGTTTTCCATCCCACTGAAGGGAAACCTCATCT
CTGGGAGCTCCCAACAGATTTTTATTTGCATCACAAAAATACCATGAGACTTTTGCCAACAAGAAGAAGT
TATACTTACTGGTGGACACCAGAGGTGATAAAGCATTTACCATTGCCCTATGATGAAGTTATCTGTGCTG
TGAACTTAAAGAAGTTGATAGTGAAGAAATTCCACAAATATGAAGAAGAGATTGATATCCACAATGAGTT
CTTTCGGCCATATGAGTTGAGCAGCTTTGATGATACCTTTTGCTTGGCTATGACAAGCTCAGCACGTGAC
TTTATGCCTAAGACCGTTGGAATTGATCCAAGTCCATTTACTGTGCGTAAACCAGATGAAACTGGAAAAT
CAGTATTGGGAAACAAAAGCAATAGAGAAGAAGCTGTATTACAGCGGAAAACGGCAGCCAGCGCCCCGCC
GCCACCCAGCGAGGAGGCTGTGTCCAGCAGCTCTGAGGATGACTCTGGGACTGATCGGGAAGAAGAGGGC
TCTGTGTCTCAGCGCTCCACTCCCGTGAAGATGACTGATGCAGGAGACAGTGCCAAAGTGACCGAGAATG
TGGTCCAACCCATGAAGGAGCTATATGGAATTAACCTCTCAGATGGCCTCTCAGAAGAAGATTTCTCCAT
TTATTCAAGATTTGTTCAGCTGGGGCAGAGTCAACATAAACAAGACAAGAATAGCCAGCAGCCCTGTTCT
AGGTGCTCAGATGGAGTTATAAAACTAACACCCATCTCGGCTTTCTCGCAAGATAACATCTATGAAGTTC
AGCCCCCAAGAGTAGACAGAAAATCTACAGAGATCTTCCAAGCCCACATCCAGGCCAGCCAAGGTATCAT
GCAGCCCCTAGGAAAAGAGGACTCCTCCATGTACCGAGAGTACATCAGGAACCGCTACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207192 representing NM_014845
Red=Cloning site Green=Tags(s)

MPTAAAPIISSVQKLVLYETRARYFLVGSNNAETKYRVLKIDRTEPKDLVIIDDRHVYTQQEVRELLGRL
DLGNRTKMGQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIGGHAIYKVEDTNMIYIPNDSV
RVTHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSEMTQNRQESFDIFEDEGLI
TQGGSGVFGICSEPYMKYVWNGELLDIIKSTVHRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSKFA
GTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQA
DPFAHVAALHFDQMFQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLNQFLPPEHTIVYIPWDMAK
YTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGCVIPTGRLQTGILRTNCVDCL
DRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKI
APWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPHLWELPTDFYLHHKNTMRLLPTRRS
YTYWWTPEVIKHLPLPYDEVICAVNLKKLIVKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARD
FMPKTVGIDPSPFTVRKPDETGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEG
SVSQRSTPVKMTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCS
RCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYREYIRNRYL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014845
ORF Size 2721 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014845.1, NM_014845.2, NM_014845.3, NM_014845.4, NM_014845.5, NP_055660
RefSeq Size 3089
RefSeq ORF 2724
Locus ID 9896
Cytogenetics 6q21
Domains Syja_N
MW 103.5 kDa
Gene Summary The protein encoded by this gene belongs to the SAC domain-containing protein gene family. The SAC domain, approximately 400 amino acids in length and consisting of seven conserved motifs, has been shown to possess phosphoinositide phosphatase activity. The yeast homolog, Sac1p, is involved in the regulation of various phosphoinositides, and affects diverse cellular functions such as actin cytoskeleton organization, Golgi function, and maintenance of vacuole morphology. Membrane-bound phosphoinositides function as signaling molecules and play a key role in vesicle trafficking in eukaryotic cells. Mutations in this gene have been associated with Charcot-Marie-Tooth disease, type 4J. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations