Epsin 1(EPN1) (NM_013333) Human Tagged ORF Clone

CAT#: RC207099

EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 3

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Epsin 1(EPN1) (NM_013333) Human Tagged ORF Clone
Symbol EPN1
Synonyms EH domain-binding mitotic phosphoprotein; epsin 1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207099 representing NM_013333
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGACCTCGTCCTTGAGGCGCCAGATGAAGAACATCGTCCACAACTACTCAGAGGCGGAGATCAAGG
TTCGAGAGGCCACGAGCAATGACCCCTGGGGCCCATCCAGCTCCCTCATGTCAGAGATTGCCGACCTCAC
CTACAACGTTGTCGCCTTCTCGGAGATCATGAGCATGATCTGGAAGCGGCTCAATGACCATGGCAAGAAC
TGGCGTCACGTTTACAAGGCCATGACGCTGATGGAGTACCTCATCAAGACCGGCTCGGAGCGCGTGTCGC
AGCAGTGCAAGGAGAACATGTACGCCGTGCAGACGCTGAAGGACTTCCAGTACGTGGACCGCGACGGCAA
GGACCAGGGCGTGAACGTGCGTGAGAAAGCTAAGCAGCTGGTGGCCCTGCTGCGCGACGAGGACCGGCTG
CGGGAAGAGCGGGCGCACGCGCTCAAGACCAAGGAAAAGCTGGCACAGACCGCCACGGCCTCATCAGCAG
CTGTGGGCTCAGGCCCCCCTCCCGAGGCGGAGCAGGCGTGGCCGCAGAGCAGCGGGGAGGAGGAGCTGCA
GCTCCAGCTGGCCCTGGCCATGAGCAAGGAGGAGGCCGACCAGGAGGAGCGGATCCGTCGCGGGGATGAC
CTGCGGCTGCAGATGGCAATCGAGGAGAGCAAGAGGGAGACTGGGGGCAAGGAGGAGTCGTCCCTCATGG
ACCTTGCTGACGTCTTCACGGCCCCAGCTCCTGCCCCGACCACAGACCCCTGGGGGGGCCCAGCACCCAT
GGCTGCTGCCGTCCCCACGGCTGCCCCCACCTCGGACCCCTGGGGCGGCCCCCCTGTCCCTCCAGCTGCT
GATCCCTGGGGAGGTCCAGCCCCCACGCCGGCCTCTGGGGACCCCTGGAGGCCTGCTGCCCCTGCAGGAC
CCTCAGTTGACCCTTGGGGTGGGACCCCAGCCCCTGCAGCTGGGGAGGGGCCCACGCCTGATCCATGGGG
AAGTTCCGATGGTGGGGTCCCGGTCAGTGGGCCCTCAGCCTCCGATCCCTGGACACCGGCCCCGGCCTTC
TCAGATCCCTGGGGAGGGTCACCTGCCAAGCCCAGCACCAATGGCACAACAGCCGGGGGATTCGACACGG
AGCCCGACGAGTTCTCTGACTTTGACCGACTCCGCACGGCACTGCCGACCTCCGGGAGCAGCGCAGGAGA
GCTGGAGCTGCTGGCAGGAGAGGTGCCGGCCCGAAGCCCTGGGGCGTTTGACATGAGTGGGGTCAGGGGA
TCTCTGGCTGAGGCTGTGGGCAGCCCCCCACCTGCAGCCACACCAACTCCCACGCCCCCCACCCGGAAGA
CGCCGGAGTCATTCCTGGGGCCCAATGCAGCCCTCGTCGACCTGGACTCGCTGGTGAGCCGGCCGGGCCC
CACGCCGCCTGGAGCCAAGGCCTCCAACCCCTTCCTGCCAGGCGGAGGCCCAGCCACTGGCCCTTCCGTC
ACCAACCCCTTCCAGCCCGCGCCTCCCGCGACGCTCACCCTGAACCAGCTCCGTCTCAGTCCTGTGCCTC
CCGTCCCTGGAGCGCCACCCACGTACATCTCTCCCCTTGGCGGGGGCCCTGGCCTGCCCCCCATGATGCC
CCCGGGCCCCCCGGCCCCCAACACTAATCCCTTCCTCCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207099 representing NM_013333
Red=Cloning site Green=Tags(s)

MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKN
WRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRL
REERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEELQLQLALAMSKEEADQEERIRRGDD
LRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPPVPPAA
DPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAF
SDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRG
SLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPGGGPATGPSV
TNPFQPAPPATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013333
ORF Size 1650 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013333.1, NM_013333.2, NM_013333.3, NP_037465
RefSeq Size 2430
RefSeq ORF 1653
Locus ID 29924
Cytogenetics 19q13.42
Domains ENTH, UIM
Protein Pathways Endocytosis
MW 57.3 kDa
Gene Summary This gene encodes a member of the epsin protein family. The encoded protein binds clathrin and is involved in the endocytosis of clathrin-coated vesicles. Loss of function of this gene is associated with reduced tumor growth and progression in certain cancer types. [provided by RefSeq, Mar 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations