ELL2 (NM_012081) Human Tagged ORF Clone

CAT#: RC206204

ELL2 (Myc-DDK-tagged)-Human elongation factor, RNA polymerase II, 2 (ELL2)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ELL2 (NM_012081) Human Tagged ORF Clone
Symbol ELL2
Synonyms ELL-related RNA polymerase II, elongation factor; elongation factor, RNA polymerase II, 2
Vector pCMV6-Entry
Sequence Data
>RC206204 representing NM_012081
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGGGGGGACAGGGGGCCTGCGGGAGGAGCAGCGCTATGGGCTGTCGTGCGGACGGCTGGGGC
AGGACAACATCACCGTACTGCATGTGAAGCTCACCGAGACGGCGATCCGGGCGCTCGAGACTTACCAGAG
CCACAAGAATTTAATTCCTTTTCGACCTTCAATCCAGTTCCAAGGACTCCACGGGCTTGTCAAAATTCCC
AAAAATGATCCCCTCAATGAAGTTCATAACTTTAACTTTTATTTGTCAAATGTGGGCAAAGACAACCCTC
AGGGCAGCTTTGACTGCATCCAGCAAACATTCTCCAGCTCTGGAGCCTCCCAGCTCAATTGCCTGGGATT
TATACAAGATAAAATTACAGTGTGTGCAACAAACGACTCGTATCAGATGACACGAGAAAGAATGACCCAG
GCAGAGGAGGAATCCCGCAACCGAAGCACAAAAGTTATCAAACCCGGTGGACCATATGTAGGGAAAAGAG
TGCAAATTCGGAAAGCACCTCAAGCTGTTTCAGATACAGTTCCTGAGAGGAAAAGGTCAACCCCCATGAA
CCCTGCAAATACAATTCGAAAGACACATAGCAGCAGCACCATCTCTCAGAGGCCATACAGGGACAGGGTG
ATTCACTTACTGGCCCTGAAGGCCTACAAGAAACCGGAGCTACTTGCTAGACTCCAGAAAGATGGTGTCA
ATCAAAAAGACAAGAACTCCCTGGGAGCAATTCTGCAACAGGTAGCCAATCTGAATTCTAAGGACCTCTC
ATATACCTTAAAGGATTATGTTTTTAAAGAGCTTCAAAGAGACTGGCCTGGATACAGTGAAATAGACAGA
CGGTCATTGGAGTCAGTGCTCTCTAGAAAACTAAATCCGTCTCAGAATGCTACAGGCACCAGCCGTTCAG
AATCTCCTGTATGTTCTAGTAGAGATGCTGTATCTTCTCCTCAGAAACGGCTTTTGGATTCAGAGTTTAT
TGATCCTTTAATGAATAAAAAAGCCCGAATATCTCACCTGACGAACAGAGTACCACCAACACTAAATGGT
CATTTGAATCCCACCAGTGAAAAATCGGCTGCAGGCCTCCCACTGCCCCCTGCGGCTGCTGCCATCCCCA
CCCCTCCACCGCTGCCTTCAACCTATCTGCCCATCTCACATCCTCCTCAGATTGTAAATTCTAACTCCAA
CTCCCCTAGCACTCCAGAAGGCCGGGGGACTCAAGACCTACCTGTTGACAGTTTTAGTCAAAACGATAGT
ATCTATGAGGACCAGCAAGACAAATATACCTCTAGGACTTCTCTGGAAACCTTACCCCCTGGTTCCGTTC
TACTAAAGTGTCCAAAGCCTATGGAAGAAAACCATTCAATGTCTCACAAAAAGTCCAAAAAGAAGTCTAA
AAAACATAAGGAAAAGGACCAAATAAAAAAGCACGACATTGAGACTATTGAGGAAAAGGAGGAAGATCTT
AAGAGAGAAGAGGAAATTGCCAAGCTAAATAACTCCAGTCCAAATTCCAGTGGAGGAGTTAAAGAGGATT
GCACTGCCTCCATGGAACCTTCAGCAATTGAACTCCCAGATTATTTGATAAAATATATCGCTATCGTCTC
CTATGAGCAACGCCAGAATTATAAGGATGACTTCAATGCAGAGTATGATGAGTACAGAGCTTTGCATGCC
AGGATGGAGACTGTAGCTAGAAGATTTATCAAACTAGATGCACAAAGAAAGCGCCTTTCTCCAGGCTCAA
AAGAGTATCAGAATGTTCATGAAGAAGTCTTACAAGAATATCAGAAGATAAAGCAGTCTAGTCCCAATTA
CCATGAAGAAAAATACAGATGTGAATATCTTCATAACAAGCTGGCTCACATCAAAAGGCTAATAGGTGAA
TTTGACCAACAGCAAGCAGAGTCATGGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206204 representing NM_012081
Red=Cloning site Green=Tags(s)

MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGLVKIP
KNDPLNEVHNFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQ
AEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAVSDTVPERKRSTPMNPANTIRKTHSSSTISQRPYRDRV
IHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDR
RSLESVLSRKLNPSQNATGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNG
HLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDS
IYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDL
KREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHA
RMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE
FDQQQAESWS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012081
ORF Size 1920 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012081.1, NM_012081.2, NM_012081.3, NM_012081.4, NM_012081.5, NP_036213
RefSeq Size 3767
RefSeq ORF 1923
Locus ID 22936
Cytogenetics 5q15
Protein Families Transcription Factors
MW 72.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)