FATE1 (NM_033085) Human Tagged ORF Clone

CAT#: RC205951

Reviews ()
Write a review

FATE1 (Myc-DDK-tagged)-Human fetal and adult testis expressed 1 (FATE1)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 429.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FATE1
Synonyms CT43; FATE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205951 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGAGGCCCTCCCAACACCAAGGCGGAGATGGAAATGTCCCTGGCAGAAGAACTGAATCATGGAC
GCCAAGGGGAAAACCAAGAGCACCTGGTGATAGCAGAAATGATGGAGCTTGGATCTCGGTCCCGGGGTGC
CTCCCAGAAGAAGCAGAAGTTGGAACAAAAAGCTGCTGGCTCTGCTTCAGCCAAACGAGTTTGGAATATG
ACTGCCACCCGACCCAAGAAAATGGGGTCCCAGCTGCCAAAGCCCAGAATGCTGAGAGAATCAGGCCATG
GGGATGCCCATCTCCAGGAGTACGCTGGCAATTTCCAAGGCATACGTTTCCATTATGATCGCAACCCAGG
GACAGATGCAGTGGCGCAGACTAGCCTGGAAGAGTTCAATGTACTGGAGATGGAAGTCATGAGAAGACAG
CTGTATGCAGTCAACCGGCGTCTGCGCGCCCTGGAGGAACAGGGCGCCACCTGGCGCCACAGGGAGACCC
TGATCATCGCCGTGCTGGTGTCGGCCAGCATTGCCAACCTGTGGCTGTGGATGAACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205951 protein sequence
Red=Cloning site Green=Tags(s)

MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM
TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ
LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_033085
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_033085.3
RefSeq Size 1071 bp
RefSeq ORF 552 bp
Locus ID 89885
UniProt ID Q969F0
Cytogenetics Xq28
Protein Families Transmembrane
MW 20.7 kDa
Gene Summary This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation. [provided by RefSeq, Jan 2010]
Other products for "FATE1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.