C22orf32(SMDT1) (NM_033318) Human Tagged ORF Clone

CAT#: RC205947

C22orf32 (Myc-DDK-tagged)-Human chromosome 22 open reading frame 32 (C22orf32)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name C22orf32(SMDT1) (NM_033318) Human Tagged ORF Clone
Symbol SMDT1
Synonyms C22orf32; DDDD; dJ186O1.1; EMRE
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205947 representing NM_033318
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCGGAGCGGCTCGCTGGCTAGTATTGGCACCCGTCAGGTCCGGGGCTCTCCGGAGCGGGCCTA
GCTTGAGGAAAGATGGCGATGTCTCCGCCGCATGGAGCGGCTCAGGCCGGAGCCTGGTACCGTCGGGGTC
AGTCATCGTTACCCGCAGCGGCGCCATTTTGCCCAAACCGGTGAAAATGTCCTTCGGCCTTCTGCGTGTG
TTCTCCATTGTGATCCCCTTTCTCTATGTCGGGACACTCATTAGCAAGAACTTTGCTGCTCTACTTGAGG
AACATGACATTTTTGTTCCAGAGGATGATGATGATGATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205947 representing NM_033318
Red=Cloning site Green=Tags(s)

MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSGSVIVTRSGAILPKPVKMSFGLLRV
FSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_033318
ORF Size 321 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_033318.1, NM_033318.2, NM_033318.3, NM_033318.4, NP_201575
RefSeq Size 1581
RefSeq ORF 324
Locus ID 91689
Cytogenetics 22q13.2
Protein Families Transmembrane
MW 11.2 kDa
Gene Summary This gene encodes a core regulatory component of a calcium channel in the mitochondrial inner membrane. [provided by RefSeq, Apr 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)