N6AMT2(EEF1AKMT1) (NM_174928) Human Tagged ORF Clone

CAT#: RC205604

N6AMT2 (Myc-DDK-tagged)-Human N-6 adenine-specific DNA methyltransferase 2 (putative) (N6AMT2)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name N6AMT2(EEF1AKMT1) (NM_174928) Human Tagged ORF Clone
Symbol EEF1AKMT1
Synonyms ESP13; N6AMT2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205604 representing NM_174928
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGATTTGGAAGATGATGAGACACCCCAGCTTTCTGCCCATGCCTTAGCAGCTCTCCAGGAATTTT
ATGCTGAGCAAAAGCAACAAATTGAGCCAGGCGAGGATGATAAATATAACATTGGAATAATAGAAGAGAA
TTGGCAACTGAGCCAGTTTTGGTATAGTCAGGAAACTGCTCTGCAGCTGGCACAGGAGGCAATTGCAGCT
GTAGGAGAAGGTGGCAGAATCGCATGTGTGAGTGCCCCTAGTGTTTACCAGAAACTCAGAGAGCTGTGCA
GAGAAAACTTTTCGATATACATCTTTGAATATGACAAAAGATTTGCCATGTATGGAGAGGAGTTTATTTT
CTATGATTACAATAATCCATTGGACTTACCCGAAAGAATTGCTGCACATAGTTTTGACATCGTAATAGCA
GATCCTCCCTATCTTTCGGAGGAATGTCTCAGAAAAACATCGGAAACCGTCAAGTACCTGACGCGGGGCA
AGATTCTGCTGTGCACAGGTGCCATCATGGAAGAACAGGCAGCAGAACTCCTTGGAGTGAAGATGTGCAC
GTTTGTTCCAAGACACACCCGGAACTTGGCAAATGAGTTTCGCTGTTATGTGAATTATGATTCTGGGCTG
GACTGTGGGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205604 representing NM_174928
Red=Cloning site Green=Tags(s)

MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAA
VGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIA
DPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGL
DCGI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_174928
ORF Size 642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_174928.1, NM_174928.2, NP_777588
RefSeq Size 890
RefSeq ORF 645
Locus ID 221143
Cytogenetics 13q12.11
MW 24.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)