N6AMT2 (EEF1AKMT1) (NM_174928) Human Tagged ORF Clone

CAT#: RC205604

Reviews ()
Write a review

N6AMT2 (Myc-DDK-tagged)-Human N-6 adenine-specific DNA methyltransferase 2 (putative) (N6AMT2)



Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Other products for "EEF1AKMT1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol EEF1AKMT1
Synonyms ESP13; N6AMT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205604 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGATTTGGAAGATGATGAGACACCCCAGCTTTCTGCCCATGCCTTAGCAGCTCTCCAGGAATTTT
ATGCTGAGCAAAAGCAACAAATTGAGCCAGGCGAGGATGATAAATATAACATTGGAATAATAGAAGAGAA
TTGGCAACTGAGCCAGTTTTGGTATAGTCAGGAAACTGCTCTGCAGCTGGCACAGGAGGCAATTGCAGCT
GTAGGAGAAGGTGGCAGAATCGCATGTGTGAGTGCCCCTAGTGTTTACCAGAAACTCAGAGAGCTGTGCA
GAGAAAACTTTTCGATATACATCTTTGAATATGACAAAAGATTTGCCATGTATGGAGAGGAGTTTATTTT
CTATGATTACAATAATCCATTGGACTTACCCGAAAGAATTGCTGCACATAGTTTTGACATCGTAATAGCA
GATCCTCCCTATCTTTCGGAGGAATGTCTCAGAAAAACATCGGAAACCGTCAAGTACCTGACGCGGGGCA
AGATTCTGCTGTGCACAGGTGCCATCATGGAAGAACAGGCAGCAGAACTCCTTGGAGTGAAGATGTGCAC
GTTTGTTCCAAGACACACCCGGAACTTGGCAAATGAGTTTCGCTGTTATGTGAATTATGATTCTGGGCTG
GACTGTGGGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205604 protein sequence
Red=Cloning site Green=Tags(s)

MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAA
VGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIA
DPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGL
DCGI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_174928
ORF Size 642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_174928.2
RefSeq Size 890 bp
RefSeq ORF 645 bp
Locus ID 221143
UniProt ID Q8WVE0
Cytogenetics 13q12.11
MW 24.5 kDa
Gene Summary Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79'.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.