CAMK2G (NM_172169) Human Tagged ORF Clone

CAT#: RC205437

Reviews ()
Write a review

CAMK2G (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase II gamma (CAMK2G), transcript variant 2



  "NM_172169" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name CAMK2G (NM_172169) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CAMK2G
Synonyms CAMK; CAMK-II; CAMKG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205437 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCACCGCCACCTGCACACGTTTCACCGACGACTACCAGCTCTTCGAGGAGCTTGGCAAGGGTG
CTTTCTCTGTGGTCCGCAGGTGTGTGAAGAAAACCCCCACGCAGGAGTACGCAGCAAAAATCATCAATAC
CAAGAAATTGTCTGCCCGGGATCACCAGAAACTAGAACGTGAGGCTCGGATATGTCGACTTCTGAAACAT
CCAAACATCGTGCGCCTCCATGACAGTATTTCTGAAGAAGGGTTTCACTACCTCGTGTTTGACCTTGTTA
CCGGCGGGGAGCTGTTTGAAGACATTGTGGCCAGAGAGTACTACAGTGAAGCAGATGCCAGCCACTGTAT
ACATCAGATTCTGGAGAGTGTTAACCACATCCACCAGCATGACATCGTCCACAGGGACCTGAAGCCTGAG
AACCTGCTGCTGGCGAGTAAATGCAAGGGTGCCGCCGTCAAGCTGGCTGATTTTGGCCTAGCCATCGAAG
TACAGGGAGAGCAGCAGGCTTGGTTTGGTTTTGCTGGCACCCCAGGTTACTTGTCCCCTGAGGTCTTGAG
GAAAGATCCCTATGGAAAACCTGTGGATATCTGGGCCTGCGGGGTCATCCTGTATATCCTCCTGGTGGGC
TATCCTCCCTTCTGGGATGAGGATCAGCACAAGCTGTATCAGCAGATCAAGGCTGGAGCCTATGATTTCC
CATCACCAGAATGGGACACGGTAACTCCTGAAGCCAAGAACTTGATCAACCAGATGCTGACCATAAACCC
AGCAAAGCGCATCACGGCTGACCAGGCTCTCAAGCACCCGTGGGTCTGTCAACGATCCACGGTGGCATCC
ATGATGCATCGTCAGGAGACTGTGGAGTGTTTGCGCAAGTTCAATGCCCGGAGAAAACTGAAGGGTGCCA
TCCTCACGACCATGCTTGTCTCCAGGAACTTCTCAGTTGGCAGGCAGAGCTCCGCCCCCGCCTCGCCTGC
CGCGAGCGCCGCCGGCCTGGCCGGGCAAGCTGCCAAAAGCCTATTGAACAAGAAGTCGGATGGCGGTGTC
AAGAAAAGGAAGTCGAGTTCCAGCGTGCACCTAATGGAGCCACAAACCACTGTGGTACACAACGCTACAG
ATGGGATCAAGGGCTCCACAGAGAGCTGCAACACCACCACAGAAGATGAGGACCTCAAAGTGCGAAAACA
GGAGATCATTAAGATTACAGAACAGCTGATTGAAGCCATCAACAATGGGGACTTTGAGGCCTACACGAAG
ATTTGTGATCCAGGCCTCACTTCCTTTGAGCCTGAGGCCCTTGGTAACCTCGTGGAGGGGATGGATTTCC
ATAAGTTTTACTTTGAGAATCTCCTGTCAAAGAACAGCAAGCCTATCCATACCACCATCCTAAACCCACA
CGTCCACGTGATTGGGGAGGACGCAGCGTGCATCGCCTACATCCGCCTCACCCAGTACATCGACGGGCAG
GGTCGGCCTCGCACCAGCCAGTCAGAAGAGACCCGGGTCTGGCACCGTCGGGATGGCAAGTGGCTCAATG
TCCACTATCACTGCTCAGGGGCCCCTGCCGCACCGCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205437 protein sequence
Red=Cloning site Green=Tags(s)

MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTPTQEYAAKIINTKKLSARDHQKLEREARICRLLKH
PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPE
NLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVG
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVAS
MMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGV
KKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTK
ICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQ
GRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_172169
ORF Size 1581 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_172169.1, NM_172169.2, NP_751909.1
RefSeq Size 3731 bp
RefSeq ORF 1584 bp
Locus ID 818
Cytogenetics 10q22.2
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway
MW 59 kDa
Gene Summary The product of this gene is one of the four subunits of an enzyme which belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a gamma chain. Many alternatively spliced transcripts encoding different isoforms have been described but the full-length nature of all the variants has not been determined. [provided by RefSeq, Mar 2011]

Other Versions

Other products for "CAMK2G"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit polyclonal anti-CaMK2 beta/gamma antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools