GABA A Receptor alpha 1(GABRA1) (NM_000806) Human Tagged ORF Clone

CAT#: RC205390

GABRA1 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, alpha 1 (GABRA1), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 4 publications.

Product images

Specifications

Product Data
Product Name GABA A Receptor alpha 1(GABRA1) (NM_000806) Human Tagged ORF Clone
Symbol GABRA1
Synonyms ECA4; EIEE19; EJM; EJM5
Vector pCMV6-Entry
Sequence Data
>RC205390 representing NM_000806
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAAAAGTCCAGGTCTGTCTGACTGTCTTTGGGCCTGGATCCTCCTTCTGAGCACACTGACTGGAA
GAAGCTATGGACAGCCGTCATTACAAGATGAACTTAAAGACAATACCACTGTCTTCACCAGGATTTTGGA
CAGACTCCTAGATGGTTATGACAATCGCCTGAGACCAGGATTGGGAGAGCGTGTAACCGAAGTGAAGACT
GATATCTTCGTCACCAGTTTCGGACCCGTTTCAGACCATGATATGGAATATACAATAGATGTATTTTTCC
GTCAAAGCTGGAAGGATGAAAGGTTAAAATTTAAAGGACCTATGACAGTCCTCCGGTTAAATAACCTAAT
GGCAAGTAAAATCTGGACTCCGGACACATTTTTCCACAATGGAAAGAAGTCAGTGGCCCACAACATGACC
ATGCCCAACAAACTCCTGCGGATCACAGAGGATGGCACCTTGCTGTACACCATGAGGCTGACAGTGAGAG
CTGAATGTCCGATGCATTTGGAGGACTTCCCTATGGATGCCCATGCTTGCCCACTAAAATTTGGAAGTTA
TGCTTATACAAGAGCAGAAGTTGTTTATGAATGGACCAGAGAGCCAGCACGCTCAGTGGTTGTAGCAGAA
GATGGATCACGTCTAAACCAGTATGACCTTCTTGGACAAACAGTAGACTCTGGAATTGTCCAGTCAAGTA
CAGGAGAATATGTTGTTATGACCACTCATTTCCACTTGAAGAGAAAGATTGGCTACTTTGTTATTCAAAC
ATACCTGCCATGCATAATGACAGTGATTCTCTCACAAGTCTCCTTCTGGCTCAACAGAGAGTCTGTACCA
GCAAGAACTGTCTTTGGAGTAACAACTGTGCTCACCATGACAACATTGAGCATCAGTGCCAGAAACTCCC
TCCCTAAGGTGGCTTATGCAACAGCTATGGATTGGTTTATTGCCGTGTGCTATGCCTTTGTGTTCTCAGC
TCTGATTGAGTTTGCCACAGTAAACTATTTCACTAAGAGAGGTTATGCATGGGATGGCAAAAGTGTGGTT
CCAGAAAAGCCAAAGAAAGTAAAGGATCCTCTTATTAAGAAAAACAACACTTACGCTCCAACAGCAACCA
GCTACACCCCTAATTTGGCCAGGGGCGACCCGGGCTTAGCCACCATTGCTAAAAGTGCAACCATAGAACC
TAAAGAGGTCAAGCCCGAAACAAAACCACCAGAACCCAAGAAAACCTTTAACAGTGTCAGCAAAATTGAC
CGACTGTCAAGAATAGCCTTCCCGCTGCTATTTGGAATCTTTAACTTAGTCTACTGGGCTACGTATTTAA
ACAGAGAGCCTCAGCTAAAAGCCCCCACACCACATCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205390 representing NM_000806
Red=Cloning site Green=Tags(s)

MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKT
DIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMT
MPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAE
DGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVP
ARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVV
PEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000806
ORF Size 1368 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000806.1, NM_000806.2, NM_000806.3, NM_000806.4, NM_000806.5, NP_000797
RefSeq Size 3678
RefSeq ORF 1371
Locus ID 2554
Cytogenetics 5q34
Domains Neur_chan_memb, Neur_chan_LBD
Protein Families Ion Channels: Cys-loop Receptors, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 51.6 kDa
Gene Summary This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene cause juvenile myoclonic epilepsy and childhood absence epilepsy type 4. Multiple transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (4)