PDE1A (NM_005019) Human Tagged ORF Clone

CAT#: RC205292

Reviews ()
Write a review

PDE1A (Myc-DDK-tagged)-Human phosphodiesterase 1A, calmodulin-dependent (PDE1A), transcript variant 1



  "NM_005019" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDE1A
Synonyms CAM-PDE-1A; CAM-PDE 1A; HCAM-1; HCAM1; HSPDE1A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205292 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTCTAGTGCCACAGAGATTGAAGAATTGGAAAACACCACTTTTAAGTATCTTACAGGAGAACAGA
CTGAAAAAATGTGGCAGCGCCTGAAAGGAATACTAAGATGCTTGGTGAAGCAGCTGGAAAGAGGTGATGT
TAACGTCGTCGACTTAAAGAAGAATATTGAATATGCGGCATCTGTGCTGGAAGCAGTTTATATCGATGAA
ACAAGAAGACTTCTGGATACTGAAGATGAGCTCAGTGACATTCAGACTGACTCAGTCCCATCTGAAGTCC
GGGACTGGTTGGCTTCTACCTTTACACGGAAAATGGGGATGACAAAAAAGAAACCTGAGGAAAAACCAAA
ATTTCGGAGCATTGTGCATGCTGTTCAAGCTGGAATTTTTGTGGAAAGAATGTACCGAAAAACATATCAT
ATGGTTGGTTTGGCATATCCAGCAGCTGTCATCGTAACATTAAAGGATGTTGATAAATGGTCTTTCGATG
TATTTGCCCTAAATGAAGCAAGTGGAGAGCATAGTCTGAAGTTTATGATTTATGAACTGTTTACCAGATA
TGATCTTATCAACCGTTTCAAGATTCCTGTTTCTTGCCTAATCACCTTTGCAGAAGCTTTAGAAGTTGGT
TACAGCAAGTACAAAAATCCATATCACAATTTGATTCATGCAGCTGATGTCACTCAAACTGTGCATTACA
TAATGCTTCATACAGGTATCATGCACTGGCTCACTGAACTGGAAATTTTAGCAATGGTCTTTGCTGCTGC
CATTCATGATTATGAGCATACAGGGACAACAAACAACTTTCACATTCAGACAAGGTCAGATGTTGCCATT
TTGTATAATGATCGCTCTGTCCTTGAGAATCACCACGTGAGTGCAGCTTATCGACTTATGCAAGAAGAAG
AAATGAATATCTTGATAAATTTATCCAAAGATGACTGGAGGGATCTTCGGAACCTAGTGATTGAAATGGT
TTTATCTACAGACATGTCAGGTCACTTCCAGCAAATTAAAAATATAAGAAACAGTTTGCAGCAGCCTGAA
GGGATTGACAGAGCCAAAACCATGTCCCTGATTCTCCACGCAGCAGACATCAGCCACCCAGCCAAATCCT
GGAAGCTGCATTATCGGTGGACCATGGCCCTAATGGAGGAGTTTTTCCTGCAGGGAGATAAAGAAGCTGA
ATTAGGGCTTCCATTTTCCCCACTTTGTGATCGGAAGTCAACCATGGTGGCCCAGTCACAAATAGGTTTC
ATCGATTTCATAGTAGAGCCAACATTTTCTCTTCTGACAGACTCAACAGAGAAAATTGTTATTCCTCTTA
TAGAGGAAGCCTCAAAAGCCGAAACTTCTTCCTATGTGGCAAGCAGCTCAACCACCATTGTGGGGTTACA
CATTGCTGATGCACTAAGACGATCAAATACAAAAGGCTCCATGAGTGATGGGTCCTATTCCCCAGACTAC
TCCCTTGCAGCAGTGGACCTGAAGAGTTTCAAGAACAACCTGGTGGACATCATTCAGCAGAACAAAGAGA
GGTGGAAAGAGTTAGCTGCACAAGGTGAATCTGATCTTCATAAGAACTCAGAAGACTTAGTAAATGCTGA
AGAAAAACATGATGAGACACATTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205292 protein sequence
Red=Cloning site Green=Tags(s)

MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAASVLEAVYIDE
TRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRSIVHAVQAGIFVERMYRKTYH
MVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIPVSCLITFAEALEVG
YSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAI
LYNDRSVLENHHVSAAYRLMQEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPE
GIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGSMSDGSYSPDY
SLAAVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDETHS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005019
ORF Size 1635 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005019.5
RefSeq Size 4918 bp
RefSeq ORF 1638 bp
Locus ID 5136
UniProt ID P54750
Cytogenetics 2q32.1
Domains PDEase
Protein Families Druggable Genome
Protein Pathways Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism, Taste transduction
MW 62.3 kDa
Gene Summary Cyclic nucleotide phosphodiesterases (PDEs) play a role in signal transduction by regulating intracellular cyclic nucleotide concentrations through hydrolysis of cAMP and/or cGMP to their respective nucleoside 5-prime monophosphates. Members of the PDE1 family, such as PDE1A, are Ca(2+)/calmodulin (see CALM1; MIM 114180)-dependent PDEs (CaM-PDEs) that are activated by calmodulin in the presence of Ca(2+) (Michibata et al., 2001 [PubMed 11342109]; Fidock et al., 2002 [PubMed 11747989]).[supplied by OMIM, Oct 2009]

Other Versions

Other products for "PDE1A"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


PDE1A mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.