INSIG2 (NM_016133) Human Tagged ORF Clone

CAT#: RC205274

INSIG2 (Myc-DDK-tagged)-Human insulin induced gene 2 (INSIG2)

Product Images

Circular map for RC205274

• 

  Western blot validation of overexpression lysate (Cat# LY402504) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC205274 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified INSIG2 protein (Cat# TP305274). The protein was produced from HEK293T cells transfected with INSIG2 cDNA clone (Cat# RC205274) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: INSIG2
• Synonyms: INSIG-2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205274 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAGAAGGAGAGACAGAGTCACCTGGGCCCAAAAAGTGTGGCCCATATATTTCATCTGTCACTAGCC
  AGAGTGTGAACTTGATGATTCGAGGAGTAGTGCTATTTTTTATTGGAGTATTTCTTGCATTAGTGTTAAA
  TTTACTTCAGATTCAGAGAAATGTGACGCTCTTTCCACCTGATGTGATTGCAAGCATCTTTTCTTCTGCA
  TGGTGGGTACCCCCATGCTGTGGCACGGCTTCAGCTGTGATTGGGTTATTATACCCCTGCATTGACAGAC
  ATCTAGGAGAACCACATAAATTTAAAAGAGAGTGGTCCAGTGTAATGCGGTGTGTAGCAGTCTTTGTTGG
  TATAAATCATGCCAGTGCTAAAGTGGATTTCGATAACAACATACAGTTGTCTCTCACACTGGCTGCACTA
  TCCATTGGACTGTGGTGGACTTTTGATAGATCTAGAAGTGGTTTTGGCCTTGGAGTAGGAATTGCCTTCT
  TGGCAACTGTGGTCACTCAACTGCTAGTATATAATGGTGTTTACCAATATACATCTCCAGATTTCCTCTA
  TGTTCGTTCTTGGTTACCATGTATATTTTTTGCTGGAGGCATAACAATGGGAAACATTGGTCGACAACTG
  GCAATGTACGAATGTAAAGTTATCGCAGAAAAATCTCATCAGGAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205274 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSA
  WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAAL
  SIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQL
  AMYECKVIAEKSHQE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_016133
• ORF Size: 675 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_016133.4
• RefSeq Size: 2592 bp
• RefSeq ORF: 678 bp
• Locus ID: 51141
• UniProt ID: Q9Y5U4
• Cytogenetics: 2q14.1-q14.2
• Protein Families: Transmembrane
• MW: 24.8 kDa
• Gene Summary: The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq, Jul 2008]