GLYATL2 (NM_145016) Human Tagged ORF Clone

CAT#: RC205043

GLYATL2 (Myc-DDK-tagged)-Human glycine-N-acyltransferase-like 2 (GLYATL2)

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GLYATL2 (NM_145016) Human Tagged ORF Clone
Symbol GLYATL2
Synonyms BXMAS2-10; GATF-B
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205043 representing NM_145016
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTGTGCTTCATAACTCTCAGAAGCTGCAGATTCTGTATAAATCCTTAGAAAAGAGCATCCCTGAAT
CCATAAAGGTATATGGCGCCATTTTCAACATAAAAGATAAAAACCCTTTCAACATGGAGGTGCTGGTAGA
TGCCTGGCCAGATTACCAGATCGTCATTACCCGGCCTCAGAAACAGGAGATGAAAGATGACCAGGATCAT
TATACCAACACTTACCACATCTTCACCAAAGCTCCTGACAAATTAGAGGAAGTCCTGTCATACTCCAATG
TAATCAGCTGGGAGCAAACTTTGCAGATCCAAGGTTGCCAAGAGGGCTTGGATGAAGCAATAAGAAAGGT
TGCAACTTCAAAATCAGTGCAGGTAGATTACATGAAAACCATCCTCTTTATACCGGAATTACCAAAGAAA
CACAAGACCTCAAGTAATGACAAGATGGAGTTATTTGAAGTGGATGATGATAACAAGGAAGGAAACTTTT
CAAACATGTTCTTAGATGCTTCACATGCAGGTCTTGTGAATGAACACTGGGCCTTTGGGAAAAATGAGAG
GAGCTTGAAATATATTGAACGCTGCCTCCAGGATTTTCTAGGATTTGGTGTGCTGGGTCCAGAGGGCCAG
CTTGTCTCTTGGATTGTGATGGAACAGTCCTGTGAGTTGAGAATGGGTTATACTGTCCCCAAATACAGAC
ACCAAGGCAACATGTTGCAAATTGGTTATCATCTTGAAAAGTATCTTTCTCAGAAAGAAATCCCATTTTA
TTTCCATGTGGCAGATAATAATGAGAAAAGCCTACAGGCACTGAACAATTTGGGGTTTAAGATTTGTCCT
TGTGGCTGGCATCAGTGGAAATGCACCCCCAAGAAATATTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205043 representing NM_145016
Red=Cloning site Green=Tags(s)

MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDH
YTNTYHIFTKAPDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKK
HKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQ
LVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICP
CGWHQWKCTPKKYC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_145016
ORF Size 882 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_145016.1, NM_145016.2, NM_145016.3, NP_659453
RefSeq Size 1636
RefSeq ORF 885
Locus ID 219970
Cytogenetics 11q12.1
MW 34.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)