GRO beta (CXCL2) (NM_002089) Human Tagged ORF Clone
CAT#: RC204877
- TrueORF®
CXCL2 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 2 (CXCL2)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_002089" in other vectors (7)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | GRO beta |
Synonyms | CINC-2a; GRO2; GROb; MGSA-b; MIP-2a; MIP2; MIP2A; SCYB2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204877 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCGCGCCACGCTCTCCGCCGCCCCCAGCAATCCCCGGCTCCTGCGGGTGGCGCTGCTGCTCCTGC TCCTGGTGGCCGCCAGCCGGCGCGCAGCAGGAGCGCCCCTGGCCACTGAACTGCGCTGCCAGTGCTTGCA GACCCTGCAGGGAATTCACCTCAAGAACATCCAAAGTGTGAAGGTGAAGTCCCCCGGACCCCACTGCGCC CAAACCGAAGTCATAGCCACACTCAAGAATGGGCAGAAAGCTTGTCTCAACCCCGCATCGCCCATGGTTA AGAAAATCATCGAAAAGATGCTGAAAAATGGCAAATCCAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204877 protein sequence
Red=Cloning site Green=Tags(s) MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCA QTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002089 |
ORF Size | 321 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002089.4 |
RefSeq Size | 1234 bp |
RefSeq ORF | 324 bp |
Locus ID | 2920 |
UniProt ID | P19875 |
Cytogenetics | 4q13.3 |
Domains | IL8 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway |
MW | 11.4 kDa |
Gene Summary | This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204877L1 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 2 (CXCL2), Myc-DDK-tagged |
USD 450.00 |
|
RC204877L2 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 2 (CXCL2), mGFP tagged |
USD 450.00 |
|
RC204877L3 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 2 (CXCL2), Myc-DDK-tagged |
USD 450.00 |
|
RC204877L4 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 2 (CXCL2), mGFP tagged |
USD 450.00 |
|
RG204877 | CXCL2 (tGFP-tagged) - Human chemokine (C-X-C motif) ligand 2 (CXCL2) |
USD 350.00 |
|
SC118823 | CXCL2 (untagged)-Human chemokine (C-X-C motif) ligand 2 (CXCL2) |
USD 165.00 |
|
SC320418 | CXCL2 (untagged)-Human chemokine (C-X-C motif) ligand 2 (CXCL2) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review