TID1 (DNAJA3) (NM_005147) Human Tagged ORF Clone

CAT#: RC204240

Reviews ()
Write a review

DNAJA3 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily A, member 3 (DNAJA3), transcript variant 1



  "NM_005147" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 511.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DNAJA3
Synonyms HCA57; hTID-1; TID1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204240 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCGCGGTGCTCCACACGCTGGTTGCTGGTGGTTGTGGGGACCCCGCGGCTGCCGGCTATATCGG
GTAGAGGGGCCCGGCCGCCCAGGGAGGGCGTGGTGGGGGCATGGCTGAGCCGCAAGCTGAGCGTCCCCGC
CTTTGCGTCTTCCCTGACCTCTTGCGGCCCCCGAGCGCTGCTGACATTGAGACCTGGTGTCAGCCTCACA
GGAACAAAACATTACCCTTTCATTTGTACTGCCTCCTTCCACACGAGTGCCCCTTTGGCCAAAGAAGATT
ATTATCAGATATTAGGAGTGCCTCGAAATGCCAGCCAGAAAGAGATCAAGAAAGCCTATTATCAGCTTGC
CAAGAAGTATCACCCTGACACAAATAAGGATGATCCCAAAGCCAAGGAGAAGTTCTCCCAGCTGGCAGAA
GCCTATGAGGTTTTGAGTGATGAGGTGAAGAGGAAGCAGTACGATGCCTACGGCTCTGCAGGCTTCGATC
CTGGGGCCAGCGGCTCCCAGCATAGCTACTGGAAGGGAGGCCCCACTGTGGACCCCGAGGAGCTGTTCAG
GAAGATCTTTGGCGAGTTCTCATCCTCTTCATTTGGAGATTTCCAGACCGTGTTTGATCAGCCTCAGGAA
TACTTCATGGAGTTGACATTCAATCAAGCTGCAAAGGGGGTCAACAAGGAGTTCACCGTGAACATCATGG
ACACGTGTGAGCGCTGCAACGGCAAGGGGAACGAGCCCGGCACCAAGGTGCAGCATTGCCACTACTGTGG
CGGCTCCGGCATGGAAACCATCAACACAGGCCCTTTTGTGATGCGTTCCACGTGTAGGAGATGTGGTGGC
CGCGGCTCCATCATCATATCGCCCTGTGTGGTCTGCAGGGGAGCAGGACAAGCCAAGCAGAAAAAGCGAG
TGATGATCCCTGTGCCTGCAGGAGTCGAGGATGGCCAGACCGTGAGGATGCCTGTGGGAAAAAGGGAAAT
TTTCATTACGTTCAGGGTGCAGAAAAGCCCTGTGTTCCGGAGGGACGGCGCAGACATCCACTCCGACCTC
TTTATTTCTATAGCTCAGGCTCTTCTTGGGGGAACAGCCAGAGCCCAGGGCCTGTACGAGACGATCAACG
TGACGATCCCCCCTGGGACTCAGACAGACCAGAAGATTCGGATGGGTGGGAAAGGCATCCCCCGGATTAA
CAGCTACGGCTACGGAGACCACTACATCCACATCAAGATACGAGTTCCAAAGAGGCTAACGAGCCGGCAG
CAGAGCCTGATCCTGAGCTACGCCGAGGACGAGACAGATGTGGAGGGGACGGTGAACGGCGTCACCCTCA
CCAGCTCTGGTGGCAGCACCATGGATAGCTCCGCAGGAAGCAAGGCTAGGCGTGAGGCTGGGGAGGACGA
GGAGGGATTCCTTTCCAAACTTAAGAAAATGTTTACCTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204240 protein sequence
Red=Cloning site Green=Tags(s)

MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLT
GTKHYPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAE
AYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQE
YFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGG
RGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDL
FISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQ
QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005147
ORF Size 1440 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005147.3, NP_005138.2
RefSeq Size 2780 bp
RefSeq ORF 1443 bp
Locus ID 9093
UniProt ID Q96EY1
Cytogenetics 16p13.3
Domains DnaJ_CXXCXGXG, DnaJ, DnaJ_C
MW 52.5 kDa
Gene Summary This gene encodes a member of the DNAJ/Hsp40 protein family. DNAJ/Hsp40 proteins stimulate the ATPase activity of Hsp70 chaperones and play critical roles in protein folding, degradation, and multimeric complex assembly. The encoded protein is localized to mitochondria and mediates several cellular processes including proliferation, survival and apoptotic signal transduction. The encoded protein also plays a critical role in tumor suppression through interactions with oncogenic proteins including ErbB2 and the p53 tumor suppressor protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011]

Other Versions

Other products for "DNAJA3"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-DNAJA3 Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.