POLR3K (NM_016310) Human Tagged ORF Clone

CAT#: RC204102

Reviews ()
Write a review

POLR3K (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa (POLR3K)


Product Datasheet for 'RC204102'


  "NM_016310" in other vectors (4)

Need a mutant or fragment? Switch to a different vector? Get a free quote.

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name POLR3K (NM_016310) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol POLR3K
Synonyms C11; C11-RNP3; My010; RPC10; RPC11; RPC12.5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204102 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTGTTCTGCCCCGGCTGCGGGAACGGGCTGATCGTGGAGGAGGGACAACGCTGCCACCGCTTCG
CCTGCAACACGTGCCCCTACGTGCACAACATCACCCGCAAGGTAACAAATCGGAAGTACCCAAAACTGAA
AGAAGTGGATGATGTGCTTGGTGGAGCAGCTGCCTGGGAGAATGTTGACTCTACTGCAGAGTCGTGTCCC
AAATGCGAACATCCTCGTGCTTACTTCATGCAGCTTCAGACCCGCTCTGCAGATGAGCCGATGACCACCT
TCTACAAGTGCTGCAATGCTCAGTGTGGACACCGCTGGAGGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204102 protein sequence
Red=Cloning site Green=Tags(s)

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP
KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016310
ORF Size 324 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016310.1, NM_016310.2, NM_016310.3, NM_016310.4, NP_057394.1
RefSeq Size 834 bp
RefSeq ORF 327 bp
Locus ID 51728
Cytogenetics 16p13.3
Domains TFIIS, RNA_POL_M_15KD
Protein Families Transcription Factors
Protein Pathways Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
MW 12.3 kDa
Gene Summary This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17. [provided by RefSeq, Jul 2010]

Other Versions

Other products for "POLR3K"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools