Adiponectin Receptor 1 (ADIPOR1) (NM_015999) Human Tagged ORF Clone

CAT#: RC203907

Reviews ()
Write a review

ADIPOR1 (Myc-DDK-tagged)-Human adiponectin receptor 1 (ADIPOR1), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADIPOR1
Synonyms ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203907 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGGAAGCTGACA
CGGTGGAACTGGCTGAACTGGGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAA
AGCTGAAGAAGAGCAAACATGCCCAGTGCCCCAGGAAGAAGAGGAGGAGGTGCGGGTACTGACACTTCCC
CTGCAAGCCCACCACGCCATGGAGAAGATGGAAGAGTTTGTGTACAAGGTCTGGGAGGGACGTTGGAGGG
TCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGCTACATGGTCATAGACCTCC
CATGCCCTCCTTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACC
CATCTGCTTGGTTTCGTGCTGTTTCTCTTTTTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCA
TGGCCCCTCTACAGGAGAAGGTGGTTTTTGGGATGTTCTTTTTGGGTGCAGTGCTCTGCCTCAGCTTCTC
CTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCTCTCGGACTTTTTCCAAACTGGACTATTCA
GGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCTCCCCACAGC
CACGGCTCATCTACCTCTCCATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCG
GTTTGCCACTCCTAAGCACCGGCAGACAAGAGCAGGCGTGTTCCTGGGACTTGGCTTGAGTGGCGTCGTG
CCCACCATGCACTTTACTATCGCTGAGGGCTTTGTCAAGGCCACCACAGTGGGCCAGATGGGCTGGTTCT
TCCTCATGGCTGTGATGTACATCACTGGAGCTGGCCTTTATGCTGCTCGAATTCCTGAGCGCTTCTTTCC
TGGAAAATTTGACATATGGTTCCAGTCTCATCAGATTTTCCATGTCCTGGTGGTGGCAGCAGCCTTTGTC
CACTTCTATGGAGTCTCCAACCTTCAGGAATTCCGTTACGGCCTAGAAGGCGGCTGTACTGATGACACCC
TTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203907 protein sequence
Red=Cloning site Green=Tags(s)

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP
LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT
HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS
GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV
PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV
HFYGVSNLQEFRYGLEGGCTDDTLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015999
ORF Size 1125 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015999.6
RefSeq Size 2184 bp
RefSeq ORF 1128 bp
Locus ID 51094
UniProt ID Q96A54
Cytogenetics 1q32.1
Domains UPF0073
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway
MW 42.6 kDa
Gene Summary This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]
Other products for "ADIPOR1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.