NORE1 (RASSF5) (NM_182665) Human Tagged ORF Clone

CAT#: RC203854

RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3

Product Images

Circular map for RC203854

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY RASSF5 (Cat# RC203854, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RASSF5(Cat# TA502509). Positive lysates LY405440 (100ug) and LC405440 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY405440) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203854 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified RASSF5 protein (Cat# TP303854). The protein was produced from HEK293T cells transfected with RASSF5 cDNA clone (Cat# RC203854) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: NORE1
• Synonyms: Maxp1; NORE1; NORE1A; NORE1B; RAPL; RASSF3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203854 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACCGTGGACAGCAGCATGAGCAGTGGGTACTGCAGCCTGGACGAGGAACTGGAAGACTGCTTCTTCA
  CTGCTAAGACTACCTTTTTCAGAAATGCGCAGAGCAAACATCTTTCAAAGAATGTCTGTAAACCTGTGGA
  GGAGACACAGCGCCCGCCCACACTGCAGGAGATCAAGCAGAAGATCGACAGCTACAACACGCGAGAGAAG
  AACTGCCTGGGCATGAAACTGAGTGAAGACGGCACCTACACGGGTTTCATCAAAGTGCATCTGAAACTCC
  GGCGGCCTGTGACGGTGCCTGCTGGGATCCGGCCCCAGTCCATCTATGATGCCATCAAGGAGGTGAACCT
  GGCGGCTACCACGGACAAGCGGACATCCTTCTACCTGCCCCTAGATGCCATCAAGCAGCTGCACATCAGC
  AGCACCACCACCGTCAGTGAGGTCATCCAGGGGCTGCTCAAGAAGTTCATGGTTGTGGACAATCCCCAGA
  AGTTTGCACTTTTTAAGCGGATACACAAGGACGGACAAGTGCTCTTCCAGAAACTCTCCATTGCTGACCG
  CCCCCTCTACCTGCGCCTGCTTGCTGGGCCTGACACGGAGGTCCTCAGCTTTGTGCTAAAGGAGAATGAA
  ACTGGAGAGGTAGAGTGGGATGCCTTCTCCATCCCTGAACTTCAGAACTTCCTAACAATCCTGGAAAAAG
  AGGAGCAGGACAAAATCCAACAAGTGCAAAAGAAGTATGACAAGTTTAGGCAGAAACTGGAGGAGGCCTT
  AAGAGAATCCCAGGGCAAACCTGGG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203854 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREK
  NCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHIS
  STTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENE
  TGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_182665
• ORF Size: 795 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_182665.4
• RefSeq Size: 3531 bp
• RefSeq ORF: 798 bp
• Locus ID: 83593
• UniProt ID: Q8WWW0
• Cytogenetics: 1q32.1
• Protein Families: Druggable Genome
• Protein Pathways: Leukocyte transendothelial migration, Non-small cell lung cancer, Pathways in cancer
• MW: 30.4 kDa
• Gene Summary: This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]