LTA (NM_000595) Human Tagged ORF Clone

CAT#: RC203741

LTA (Myc-DDK-tagged)-Human lymphotoxin alpha (TNF superfamily, member 1) (LTA), transcript variant 2

Product Images

Circular map for RC203741

• 

  Western blot validation of overexpression lysate (Cat# LY431786) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC228758 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified LTA protein (Cat# TP303741). The protein was produced from HEK293T cells transfected with LTA cDNA clone (Cat# RC203741) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: LTA
• Synonyms: LT; TNFB; TNFSF1; TNLG1E
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203741 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACACCACCTGAACGTCTCTTCCTCCCAAGGGTGCGTGGCACCACCCTACACCTCCTCCTTCTGGGGC
  TGCTGCTGGTTCTGCTGCCTGGGGCCCAGGGGCTCCCTGGTGTTGGCCTCACACCTTCAGCTGCCCAGAC
  TGCCCGTCAGCACCCCAAGATGCATCTTGCCCACAGCACCCTCAAACCTGCTGCTCACCTCATTGGAGAC
  CCCAGCAAGCAGAACTCACTGCTCTGGAGAGCAAACACGGACCGTGCCTTCCTCCAGGATGGTTTCTCCT
  TGAGCAACAATTCTCTCCTGGTCCCCACCAGTGGCATCTACTTCGTCTACTCCCAGGTGGTCTTCTCTGG
  GAAAGCCTACTCTCCCAAGGCCACCTCCTCCCCACTCTACCTGGCCCATGAGGTCCAGCTCTTCTCCTCC
  CAGTACCCCTTCCATGTGCCTCTCCTCAGCTCCCAGAAGATGGTGTATCCAGGGCTGCAGGAACCCTGGC
  TGCACTCGATGTACCACGGGGCTGCGTTCCAGCTCACCCAGGGAGACCAGCTATCCACCCACACAGATGG
  CATCCCCCACCTAGTCCTCAGCCCTAGTACTGTCTTCTTTGGAGCCTTCGCTCTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203741 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGD
  PSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSS
  QYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_000595
• ORF Size: 615 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000595.4
• RefSeq Size: 1423 bp
• RefSeq ORF: 618 bp
• Locus ID: 4049
• UniProt ID: P01374
• Cytogenetics: 6p21.33
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Antigen processing and presentation, Cytokine-cytokine receptor interaction, Type I diabetes mellitus
• MW: 22.3 kDa
• Gene Summary: The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]