UAP1 (NM_003115) Human Tagged ORF Clone

CAT#: RC203494

Reviews ()
Write a review

UAP1 (Myc-DDK-tagged)-Human UDP-N-acteylglucosamine pyrophosphorylase 1 (UAP1)



Reconstitution Protocol

USD 470.00

In Stock*

Size
    • 10 ug

Product images

Other products for "UAP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol UAP1
Synonyms AGX; AGX1; AGX2; SPAG2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203494 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACATTAATGACCTCAAACTCACGTTGTCCAAAGCTGGGCAAGAGCACCTACTACGTTTCTGGAATG
AGCTTGAAGAAGCCCAACAGGTAGAACTTTATGCAGAGCTCCAGGCCATGAACTTTGAGGAGCTGAACTT
CTTTTTCCAAAAGGCCATTGAAGGTTTTAACCAGTCTTCTTACCAAAAGAATGTGGATGCACGAATGGAA
CCTGTGCCTCGAGAGGTATTAGGCAGTGCTACAAGGGATCAAGATCAGCTCCAGGCCTGGGAAAGTGAAG
GACTTTTCCAGATTTCTCAGAATAAAGTAGCAGTTCTTCTTCTAGCTGGTGGGCAGGGGACAAGACTCGG
CGTTGCATATCCTAAGGGGATGTATGATGTTGGTTTGCCATCCCGTAAGACACTTTTTCAGATTCAAGCA
GAGCGTATCCTGAAGCTACAGCAGGTTGCTGAAAAATATTATGGCAACAAATGCATTATTCCATGGTATA
TAATGACCAGTGGCAGAACAATGGAATCTACAAAGGAGTTCTTCACCAAGCACAAGTACTTTGGTTTAAA
AAAAGAGAATGTAATCTTTTTTCAGCAAGGAATGCTCCCCGCCATGAGTTTTGATGGGAAAATTATTTTG
GAAGAGAAGAACAAAGTTTCTATGGCTCCAGATGGGAATGGTGGTCTTTATCGGGCACTTGCAGCCCAGA
ATATTGTGGAGGATATGGAGCAAAGAGGCATTTGGAGCATTCATGTCTATTGTGTTGACAACATATTAGT
AAAAGTGGCAGACCCACGGTTCATTGGATTTTGCATTCAGAAAGGAGCAGACTGTGGAGCAAAGGTGGTA
GAGAAAACGAACCCTACAGAACCAGTTGGAGTGGTTTGCCGAGTGGATGGAGTTTACCAGGTGGTAGAAT
ATAGTGAGATTTCCCTGGCAACAGCTCAAAAACGAAGCTCAGACGGACGACTGCTGTTCAATGCGGGGAA
CATTGCCAACCATTTCTTCACTGTACCATTTCTGAGAGATGTTGTCAATGTTTATGAACCTCAGTTGCAG
CACCATGTGGCTCAAAAGAAGATTCCTTATGTGGATACCCAAGGACAGTTAATTAAGCCAGACAAACCCA
ATGGAATAAAGATGGAAAAATTTGTCTTTGACATCTTCCAGTTTGCAAAGAAGTTTGTGGTATATGAAGT
ATTGCGAGAAGATGAGTTTTCCCCACTAAAGAATGCTGATAGTCAGAATGGGAAAGACAACCCTACTACT
GCAAGGCATGCTTTGATGTCCCTTCATCATTGCTGGGTCCTCAATGCAGGGGGCCATTTCATAGATGAAA
ATGGCTCTCGCCTTCCAGCAATTCCCCGCTTGAAGGATGCCAATGATGTACCAATCCAATGTGAAATCTC
TCCTCTTATCTCCTATGCTGGAGAAGGATTAGAAAGTTATGTGGCAGATAAAGAATTCCATGCACCTCTA
ATCATCGATGAGAATGGAGTTCATGAGCTGGTGAAAAATGGTATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203494 protein sequence
Red=Cloning site Green=Tags(s)

MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSYQKNVDARME
PVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQA
ERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIIL
EEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVV
EKTNPTEPVGVVCRVDGVYQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ
HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT
ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRLKDANDVPIQCEISPLISYAGEGLESYVADKEFHAPL
IIDENGVHELVKNGI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003115
ORF Size 1515 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003115.3, NP_003106.2
RefSeq Size 2344 bp
RefSeq ORF 1518 bp
Locus ID 6675
UniProt ID Q16222
Cytogenetics 1q23.3
Domains UDPGP
Protein Pathways Amino sugar and nucleotide sugar metabolism, Metabolic pathways
MW 57.1 kDa
Gene Summary Converts UTP and GlcNAc-1-P into UDP-GlcNAc, and UTP and GalNAc-1-P into UDP-GalNAc. Isoform AGX1 has 2 to 3 times higher activity towards GalNAc-1-P, while isoform AGX2 has 8 times more activity towards GlcNAc-1-P.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.