SIKE1 (NM_025073) Human Tagged ORF Clone

CAT#: RC203262

SIKE1 (Myc-DDK-tagged)-Human suppressor of IKBKE 1 (SIKE1), transcript variant 2

Product Images

Circular map for RC203262

• 

  Western blot validation of overexpression lysate (Cat# LY410899) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203262 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified SIKE1 protein (Cat# TP303262). The protein was produced from HEK293T cells transfected with SIKE1 cDNA clone (Cat# RC203262) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: SIKE1
• Synonyms: SIKE
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203262 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGCTGCACCATCGAGAAGATCCTGACAGACGCCAAGACGCTGCTGGAGAGGCTACGGGAGCACGATG
  CGGCCGCCGAGTCGCTGGTGGATCAGTCGGCGGCGCTGCACCGGCGGGTAGCAGCTATGCGGGAGGCGGG
  GACAGCGCTTCCGGACCAGTATCAAGAGGATGCATCCGATATGAAGGACATGTCCAAATACAAACCTCAC
  ATTCTGCTGTCCCAAGAGAACACACAGATTAGAGACTTGCAACAGGAAAACAGAGAGCTATGGATTTCCT
  TGGAGGAACACCAGGATGCTTTGGAACTTATCATGAGCAAATATCGGAAACAGATGTTACAGTTAATGGT
  TGCTAAAAAAGCGGTGGATGCTGAACCAGTCCTGAAAGCTCACCAGTCTCACTCTGCAGAAATTGAGAGT
  CAGATTGACAGAATCTGTGAAATGGGAGAAGTGATGAGGAAAGCAGTTCAGGTGGATGATGACCAGTTTT
  GTAAGATTCAGGAAAAATTAGCCCAATTAGAGCTTGAAAATAAGGAACTTCGAGAATTATTGTCCATCAG
  CAGTGAGTCTCTTCAAGCCAGAAAGGAAAACTCAATGGACACTGCTTCCCAAGCCATCAAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203262 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASDMKDMSKYKPH
  ILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIES
  QIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_025073
• ORF Size: 621 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_025073.3
• RefSeq Size: 5507 bp
• RefSeq ORF: 624 bp
• Locus ID: 80143
• UniProt ID: Q9BRV8
• Cytogenetics: 1p13.2
• Protein Pathways: RIG-I-like receptor signaling pathway
• MW: 23.7 kDa
• Gene Summary: SIKE interacts with IKK-epsilon (IKBKE; MIM 605048) and TBK1 (MIM 604834) and acts as a suppressor of TLR3 (MIM 603029) and virus-triggered interferon activation pathways (Huang et al., 2005 [PubMed 16281057]).[supplied by OMIM, Mar 2008]