SAP30 (NM_003864) Human Tagged ORF Clone

CAT#: RC203160

SAP30 (Myc-DDK-tagged)-Human Sin3A-associated protein, 30kDa (SAP30)

Product Images

Circular map for RC203160

• 

  Western blot validation of overexpression lysate (Cat# LY418388) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203160 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: SAP30
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203160 representing NM_003864
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAACGGCTTCACGCCTGACGAGATGAGCCGCGGCGGGGATGCGGCCGCCGCAGTGGCCGCAGTGGTCG
  CTGCCGCGGCCGCCGCCGCCTCGGCGGGGAACGGGACCGGCGCGGGCACCGGGGCTGAGGTGCCGGGCGC
  GGGGGCGGTCTCAGCGGCTGGGCCCCCGGGGGCGGCCGGGCCGGGCCCCGGGCAACTGTGCTGCCTGCGG
  GAGGATGGTGAGCGGTGCGGCCGGGCGGCAGGCAACGCCAGCTTCAGCAAGAGGATCCAGAAGAGCATCT
  CCCAGAAGAAGGTGAAGATCGAGCTGGATAAGAGCGCAAGGCATCTTTACATATGTGATTATCATAAAAA
  CTTAATTCAGAGTGTTCGAAACAGAAGAAAGAGAAAAGGGAGTGATGATGATGGAGGTGATTCACCTGTT
  CAAGATATTGATACCCCAGAGGTTGATTTATACCAATTACAAGTAAATACACTTAGGAGATACAAAAGAC
  ACTTCAAGCTACCAACCAGACCAGGACTTAATAAAGCACAACTTGTTGAGATAGTTGGTTGCCACTTTAG
  GTCTATTCCAGTGAATGAAAAAGACACCTTAACATATTTCATCTACTCAGTGAAGAATGACAAGAACAAA
  TCAGATCTCAAGGTTGATAGTGGTGTTCAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203160 representing NM_003864
  Red=Cloning site Green=Tags(s)
  
  MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLR
  EDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPV
  QDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNK
  SDLKVDSGVH
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_003864
• ORF Size: 660 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_003864.4
• RefSeq Size: 1126 bp
• RefSeq ORF: 663 bp
• Locus ID: 8819
• UniProt ID: O75446
• Cytogenetics: 4q34.1
• Protein Families: Druggable Genome, Transcription Factors
• MW: 23.1 kDa
• Gene Summary: Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP18, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This complex is active in deacetylating core histone octamers, but inactive in deacetylating nucleosomal histones. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Jul 2008]