PIGP (NM_153682) Human Tagged ORF Clone
CAT#: RC203040
PIGP (Myc-DDK-tagged)-Human phosphatidylinositol glycan anchor biosynthesis, class P (PIGP), transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_153682" in other vectors (5)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | PIGP |
Synonyms | DCRC; DCRC-S; DEE55; DSCR5; DSRC; EIEE55; PIG-P |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203040 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGGAAAATTCACCGTCGCCATTGCCAGAAAGAGCGATTTATGGCTTTGTTCTTTTCTTAAGCTCCC AATTTGGCTTCATACTTTACCTCGTGTGGGCCTTTATTCCTGAATCTTGGCTAAACTCTTTAGGTTTAAC CTATTGGCCTCAAAAATATTGGGCAGTTGCATTACCTGTCTACCTCCTTATTGCTATAGTAATTGGCTAC GTGCTCTTGTTTGGGATTAACATGATGAGTACCTCTCCACTCGACTCCATCCATACAATCACAGATAACT ATGCAAAAAATCAACAGCAGAAGAAATACCAAGAGGAGGCCATTCCAGCCTTAAGAGATATTTCTATTAG TGAAGTAAACCAAATGTTCTTTCTTGCAGCCAAAGAACTTTACACCAAAAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203040 protein sequence
Red=Cloning site Green=Tags(s) MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGY VLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_153682 |
ORF Size | 402 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_153682.3 |
RefSeq Size | 804 bp |
RefSeq ORF | 405 bp |
Locus ID | 51227 |
UniProt ID | P57054 |
Cytogenetics | 21q22.13 |
Protein Families | Transmembrane |
Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways |
MW | 15.4 kDa |
Gene Summary | This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. This gene has multiple pseudogenes and is a member of the phosphatidylinositol glycan anchor biosynthesis gene family. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Feb 2016] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203040L3 | Lenti ORF clone of Human phosphatidylinositol glycan anchor biosynthesis, class P (PIGP), transcript variant 2, Myc-DDK-tagged |
USD 450.00 |
|
RC203040L4 | Lenti ORF clone of Human phosphatidylinositol glycan anchor biosynthesis, class P (PIGP), transcript variant 2, mGFP tagged |
USD 450.00 |
|
RG203040 | PIGP (tGFP-tagged) - Human phosphatidylinositol glycan anchor biosynthesis, class P (PIGP), transcript variant 2 |
USD 350.00 |
|
SC110438 | PIGP (untagged)-Human phosphatidylinositol glycan anchor biosynthesis, class P (PIGP), transcript variant 2 |
USD 150.00 |
|
SC320893 | PIGP (untagged)-Human phosphatidylinositol glycan anchor biosynthesis, class P (PIGP), transcript variant 2 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review