OVOL2 (NM_021220) Human Tagged ORF Clone

CAT#: RC203000

OVOL2 (Myc-DDK-tagged)-Human ovo-like 2 (Drosophila) (OVOL2)

Product Images

Circular map for RC203000

• 

  Western blot validation of overexpression lysate (Cat# LY412008) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203000 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: OVOL2
• Synonyms: CHED; CHED1; CHED2; EUROIMAGE566589; PPCD1; ZNF339
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203000 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCCAAAGTCTTCCTGGTGAAGAGGAGGAGCCTGGGGGTCTCGGTCCGCAGCTGGGATGAGCTCCCGG
  ATGAGAAAAGGGCAGACACCTACATCCCAGTGGGCCTAGGCCGCCTGCTCCACGACCCCCCCGAGGACTG
  CCGCAGCGACGGCGGCAGCAGCAGCGGCAGCGGCAGCAGCAGCGCGGGGGAGCCTGGAGGAGCAGAGAGC
  AGCTCGTCCCCGCACGCCCCCGAGAGCGAAACCCCCGAGCCCGGCGACGCCGAGGGCCCCGATGGACACC
  TGGCGACCAAGCAGCGCCCGGTCGCCAGATCGAAAATCAAGTTCACCACAGGCACGTGCAGCGACTCGGT
  GGTTCACAGCTGTGACCTGTGTGGCAAGGGCTTCCGTCTGCAGCGCATGCTGAACCGTCACCTCAAGTGC
  CACAACCAGGTGAAAAGACACCTGTGCACCTTCTGCGGCAAGGGCTTCAACGACACCTTCGACCTGAAGA
  GGCACGTCCGCACACACACAGGCATTCGTCCCTACAAATGCAACGTCTGCAATAAAGCCTTCACCCAGCG
  CTGCTCTCTGGAGTCCCACCTGAAGAAAATCCATGGGGTGCAGCAGCAGTATGCCTATAAGCAGCGGCGG
  GACAAGCTCTACGTCTGCGAGGATTGCGGCTACACGGGCCCCACCCAGGAGGACCTGTACCTGCACGTGA
  ACAGTGCCCATCCGGGCAGCTCGTTTCTCAAAAAGACATCTAAAAAACTGGCAGCCCTTCTGCAGGGCAA
  GCTGACATCCGCACACCAGGAGAATACCAGCCTGAGTGAGGAGGAGGAGAGGAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203000 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAES
  SSSPHAPESETPEPGDAEGPDGHLATKQRPVARSKIKFTTGTCSDSVVHSCDLCGKGFRLQRMLNRHLKC
  HNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRR
  DKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_021220
• ORF Size: 825 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_021220.4
• RefSeq Size: 1555 bp
• RefSeq ORF: 828 bp
• Locus ID: 58495
• UniProt ID: Q9BRP0
• Cytogenetics: 20p11.23
• Protein Families: Transcription Factors
• MW: 30.4 kDa
• Gene Summary: This gene encodes a member of the evolutionarily conserved ovo-like protein family. Mammalian members of this family contain a single zinc finger domain composed of a tetrad of C2H2 zinc fingers with variable N- and C-terminal extensions that contain intrinsically disordered domains. Members of this family are involved in epithelial development and differentiation. Knockout of this gene in mouse results in early embryonic lethality with phenotypes that include neurectoderm expansion, impaired vascularization, and heart anomalies. In humans, allelic variants of this gene have been associated with posterior polymorphous corneal dystrophy. [provided by RefSeq, Apr 2016]