MRPS12 (NM_033362) Human Tagged ORF Clone
CAT#: RC202911
MRPS12 (Myc-DDK-tagged)-Human mitochondrial ribosomal protein S12 (MRPS12), nuclear gene encoding mitochondrial protein, transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_033362" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | MRPS12 |
Synonyms | MPR-S12; MT-RPS12; RPMS12; RPS12; RPSM12 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202911 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCTGGTCTGGCCTTCTCCATGGCCTCAACACGTCCCTAACTTGTGGCCCAGCTCTGGTTCCCCGGC TCTGGGCTACCTGCTCCATGGCTACCCTGAACCAGATGCACCGCCTGGGGCCCCCCAAGCGGCCGCCTCG GAAGCTGGGCCCCACGGAAGGCCGGCCGCAGCTGAAGGGTGTGGTCCTGTGCACGTTTACCCGCAAGCCG AAGAAGCCCAACTCAGCCAATCGCAAGTGCTGTCGAGTGCGGCTCAGCACTGGCCGCGAGGCCGTCTGCT TCATCCCTGGGGAGGGCCACACCCTGCAGGAGCACCAGATTGTCCTTGTGGAGGGCGGCCGCACCCAGGA CCTGCCAGGCGTCAAGCTCACCGTTGTGCGTGGCAAGTACGACTGTGGCCACGTGCAGAAGAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202911 protein sequence
Red=Cloning site Green=Tags(s) MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKP KKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_033362 |
ORF Size | 414 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_033362.4 |
RefSeq Size | 1116 bp |
RefSeq ORF | 417 bp |
Locus ID | 6183 |
UniProt ID | O15235 |
Cytogenetics | 19q13.2 |
Domains | Ribosomal_S12 |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
MW | 15.2 kDa |
Gene Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene; all three variants encode the same protein. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202911L3 | Lenti-ORF clone of MRPS12 (Myc-DDK-tagged)-Human mitochondrial ribosomal protein S12 (MRPS12), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 450.00 |
|
RC202911L4 | Lenti-ORF clone of MRPS12 (mGFP-tagged)-Human mitochondrial ribosomal protein S12 (MRPS12), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 450.00 |
|
RG202911 | MRPS12 (tGFP-tagged) - Human mitochondrial ribosomal protein S12 (MRPS12), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 350.00 |
|
SC120219 | MRPS12 (untagged)-Human mitochondrial ribosomal protein S12 (MRPS12), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review