FPR1 (NM_002029) Human Tagged ORF Clone

CAT#: RC202745

FPR1 (Myc-DDK-tagged)-Human formyl peptide receptor 1 (FPR1), transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FPR1 (NM_002029) Human Tagged ORF Clone
Symbol FPR1
Synonyms FMLP; FPR
Vector pCMV6-Entry
Sequence Data
>RC202745 representing NM_002029
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACAAATTCCTCTCTCCCCACGAACATCTCTGGAGGGACACCTGCTGTATCTGCTGGCTATCTCT
TCCTGGATATCATCACTTATCTGGTATTTGCAGTCACCTTTGTCCTCGGGGTCCTGGGCAACGGGCTTGT
GATCTGGGTGGCTGGATTCCGGATGACACACACAGTCACCACCATCAGTTACCTGAACCTGGCCGTGGCT
GACTTCTGTTTCACCTCCACTTTGCCATTCTTCATGGTCAGGAAGGCCATGGGAGGACATTGGCCTTTCG
GCTGGTTCCTGTGCAAATTCGTCTTTACCATAGTGGACATCAACTTGTTCGGAAGTGTCTTCCTGATCGC
CCTCATTGCTCTGGACCGCTGTGTTTGCGTCCTGCATCCAGTCTGGACCCAGAACCACCGCACCGTGAGC
CTGGCCAAGAAGGTGATCATTGGGCCCTGGGTGATGGCTCTGCTCCTCACATTGCCAGTTATCATTCGTG
TGACTACAGTACCTGGTAAAACGGGGACAGTAGCCTGCACTTTTAACTTTTCGCCCTGGACCAACGACCC
TAAAGAGAGGATAAATGTGGCCGTTGCCATGTTGACGGTGAGAGGCATCATCCGGTTCATCATTGGCTTC
AGCGCACCCATGTCCATCGTTGCTGTCAGTTATGGGCTTATTGCCACCAAGATCCACAAGCAAGGCTTGA
TTAAGTCCAGTCGTCCCTTACGGGTCCTCTCCTTTGTCGCAGCAGCCTTTTTTCTCTGCTGGTCCCCATA
TCAGGTGGTGGCCCTTATAGCCACAGTCAGAATCCGTGAGTTATTGCAAGGCATGTACAAAGAAATTGGT
ATTGCAGTGGATGTGACAAGTGCCCTGGCCTTCTTCAACAGCTGCCTCAACCCCATGCTCTATGTCTTCA
TGGGCCAGGACTTCCGGGAGAGGCTGATCCACGCCCTTCCCGCCAGTCTGGAGAGGGCCCTGACCGAGGA
CTCAACCCAAACTAGTGACACAGCTACCAATTCTACTTTACCTTCTGCAGAGGTGGAGTTACAGGCAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202745 representing NM_002029
Red=Cloning site Green=Tags(s)

METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVA
DFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVS
LAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGF
SAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIG
IAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002029
ORF Size 1050 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002029.1, NM_002029.2, NM_002029.3, NP_002020
RefSeq Size 1334
RefSeq ORF 1053
Locus ID 2357
Cytogenetics 19q13.41
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 38.3 kDa
Gene Summary This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation.[provided by RefSeq, Jul 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)