GABA A Receptor beta 3(GABRB3) (NM_000814) Human Tagged ORF Clone

CAT#: RC201993

GABRB3 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, beta 3 (GABRB3), transcript variant 1

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GABA A Receptor beta 3(GABRB3) (NM_000814) Human Tagged ORF Clone
Symbol GABRB3
Synonyms ECA5; EIEE43
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201993 representing NM_000814
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGGCCTTGCGGGAGGAAGGCTTTTCGGCATCTTCTCGGCCCCGGTGCTGGTGGCTGTGGTGTGCT
GCGCCCAGAGTGTGAACGATCCCGGGAACATGTCCTTTGTGAAGGAGACGGTGGACAAGCTGTTGAAAGG
CTACGACATTCGCCTAAGACCCGACTTCGGGGGTCCCCCGGTCTGCGTGGGGATGAACATCGACATCGCC
AGCATCGACATGGTTTCCGAAGTCAACATGGATTATACCTTAACCATGTATTTTCAACAATATTGGAGAG
ATAAAAGGCTCGCCTATTCTGGGATCCCTCTCAACCTCACGCTTGACAATCGAGTGGCTGACCAGCTATG
GGTGCCCGACACATATTTCTTAAATGACAAAAAGTCATTTGTGCATGGAGTGACAGTGAAAAACCGCATG
ATCCGTCTTCACCCTGATGGGACAGTGCTGTATGGGCTCAGAATCACCACGACAGCAGCATGCATGATGG
ACCTCAGGAGATACCCCCTGGACGAGCAGAACTGCACTCTGGAAATTGAAAGCTATGGCTACACCACGGA
TGACATTGAGTTTTACTGGCGAGGCGGGGACAAGGCTGTTACCGGAGTGGAAAGGATTGAGCTCCCGCAG
TTCTCCATCGTGGAGCACCGTCTGGTCTCGAGGAATGTTGTCTTCGCCACAGGTGCCTATCCTCGACTGT
CACTGAGCTTTCGGTTGAAGAGGAACATTGGATACTTCATTCTTCAGACTTATATGCCCTCTATACTGAT
AACGATTCTGTCGTGGGTGTCCTTCTGGATCAATTATGATGCATCTGCTGCTAGAGTTGCCCTCGGGATC
ACAACTGTGCTGACGATGACAACCATCAACACCCACCTTCGGGAGACCTTGCCCAAAATCCCCTATGTCA
AAGCCATTGACATGTACCTTATGGGCTGCTTCGTCTTTGTGTTCCTGGCCCTTCTGGAGTATGCCTTTGT
CAACTACATTTTCTTTGGAAGAGGCCCTCAAAGGCAGAAGAAGCTTGCAGAAAAGACAGCCAAGGCAAAG
AATGACCGTTCAAAGAGCGAAAGCAACCGGGTGGATGCTCATGGAAATATTCTGTTGACATCGCTGGAAG
TTCACAATGAAATGAATGAGGTCTCAGGCGGCATTGGCGATACCAGGAATTCAGCAATATCCTTTGACAA
CTCAGGAATCCAGTACAGGAAACAGAGCATGCCTCGAGAAGGGCATGGGCGATTCCTGGGGGACAGAAGC
CTCCCGCACAAGAAGACCCATCTACGGAGGAGGTCTTCACAGCTCAAAATTAAAATACCTGATCTAACCG
ATGTGAATGCCATAGACAGATGGTCCAGGATCGTGTTTCCATTCACTTTTTCTCTTTTCAACTTAGTTTA
CTGGCTGTACTATGTTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201993 representing NM_000814
Red=Cloning site Green=Tags(s)

MWGLAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIA
SIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRM
IRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQ
FSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGI
TTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAK
NDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000814
ORF Size 1419 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000814.1, NM_000814.2, NM_000814.3, NM_000814.4, NM_000814.5, NP_000805
RefSeq Size 5811
Locus ID 2562
Cytogenetics 15q12
Domains Neur_chan_memb, Neur_chan_LBD
Protein Families Ion Channels: Cys-loop Receptors, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 54.12 kDa
Gene Summary This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one the subunits of a multi-subunit chloride channel that serves as the receptor for gamma-aminobutyric acid, a major inhibitory neurotransmitter of the mammalian nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two other genes encoding related subunits of the family. This gene may be associated with the pathogenesis of several disorders including Angelman syndrome, Prader-Willi syndrome, nonsyndromic orofacial clefts, epilepsy and autism. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.