GABA A Receptor beta 3 (GABRB3) (NM_000814) Human Tagged ORF Clone

CAT#: RC201993

Reviews ()
Write a review

GABRB3 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, beta 3 (GABRB3), transcript variant 1



  "NM_000814" in other vectors (7)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GABRB3
Synonyms DEE43; ECA5; EIEE43
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201993 representing NM_000814
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGGGCCTTGCGGGAGGAAGGCTTTTCGGCATCTTCTCGGCCCCGGTGCTGGTGGCTGTGGTGTGCT
GCGCCCAGAGTGTGAACGATCCCGGGAACATGTCCTTTGTGAAGGAGACGGTGGACAAGCTGTTGAAAGG
CTACGACATTCGCCTAAGACCCGACTTCGGGGGTCCCCCGGTCTGCGTGGGGATGAACATCGACATCGCC
AGCATCGACATGGTTTCCGAAGTCAACATGGATTATACCTTAACCATGTATTTTCAACAATATTGGAGAG
ATAAAAGGCTCGCCTATTCTGGGATCCCTCTCAACCTCACGCTTGACAATCGAGTGGCTGACCAGCTATG
GGTGCCCGACACATATTTCTTAAATGACAAAAAGTCATTTGTGCATGGAGTGACAGTGAAAAACCGCATG
ATCCGTCTTCACCCTGATGGGACAGTGCTGTATGGGCTCAGAATCACCACGACAGCAGCATGCATGATGG
ACCTCAGGAGATACCCCCTGGACGAGCAGAACTGCACTCTGGAAATTGAAAGCTATGGCTACACCACGGA
TGACATTGAGTTTTACTGGCGAGGCGGGGACAAGGCTGTTACCGGAGTGGAAAGGATTGAGCTCCCGCAG
TTCTCCATCGTGGAGCACCGTCTGGTCTCGAGGAATGTTGTCTTCGCCACAGGTGCCTATCCTCGACTGT
CACTGAGCTTTCGGTTGAAGAGGAACATTGGATACTTCATTCTTCAGACTTATATGCCCTCTATACTGAT
AACGATTCTGTCGTGGGTGTCCTTCTGGATCAATTATGATGCATCTGCTGCTAGAGTTGCCCTCGGGATC
ACAACTGTGCTGACGATGACAACCATCAACACCCACCTTCGGGAGACCTTGCCCAAAATCCCCTATGTCA
AAGCCATTGACATGTACCTTATGGGCTGCTTCGTCTTTGTGTTCCTGGCCCTTCTGGAGTATGCCTTTGT
CAACTACATTTTCTTTGGAAGAGGCCCTCAAAGGCAGAAGAAGCTTGCAGAAAAGACAGCCAAGGCAAAG
AATGACCGTTCAAAGAGCGAAAGCAACCGGGTGGATGCTCATGGAAATATTCTGTTGACATCGCTGGAAG
TTCACAATGAAATGAATGAGGTCTCAGGCGGCATTGGCGATACCAGGAATTCAGCAATATCCTTTGACAA
CTCAGGAATCCAGTACAGGAAACAGAGCATGCCTCGAGAAGGGCATGGGCGATTCCTGGGGGACAGAAGC
CTCCCGCACAAGAAGACCCATCTACGGAGGAGGTCTTCACAGCTCAAAATTAAAATACCTGATCTAACCG
ATGTGAATGCCATAGACAGATGGTCCAGGATCGTGTTTCCATTCACTTTTTCTCTTTTCAACTTAGTTTA
CTGGCTGTACTATGTTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201993 representing NM_000814
Red=Cloning site Green=Tags(s)

MWGLAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIA
SIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRM
IRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQ
FSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGI
TTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAK
NDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000814
ORF Size 1419 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000814.6
RefSeq Size 5811 bp
RefSeq ORF 1422 bp
Locus ID 2562
UniProt ID P28472
Cytogenetics 15q12
Domains Neur_chan_memb, Neur_chan_LBD
Protein Families Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction
MW 54.12 kDa
Gene Summary This gene encodes a member of the ligand-gated ionic channel family. The encoded protein is one the subunits of a multi-subunit chloride channel that serves as the receptor for gamma-aminobutyric acid, a major inhibitory neurotransmitter of the mammalian nervous system. This gene is located on the long arm of chromosome 15 in a cluster with two other genes encoding related subunits of the family. This gene may be associated with the pathogenesis of several disorders including Angelman syndrome, Prader-Willi syndrome, nonsyndromic orofacial clefts, epilepsy and autism. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2013]

Other Versions

Other products for "GABRB3"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.