IFI27 (NM_005532) Human Tagged ORF Clone
CAT#: RC201952
- TrueORF®
IFI27 (Myc-DDK-tagged)-Human interferon, alpha-inducible protein 27 (IFI27), transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_005532" in other vectors (6)
Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | IFI27 |
Synonyms | FAM14D; ISG12; ISG12A; P27 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201952 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGGCCTCTGCTCTCACCTCATCAGCAGTGACCAGTGTGGCCAAAGTGGTCAGGGTGGCCTCTGGCT CTGCCGTAGTTTTGCCCCTGGCCAGGATTGCTACAGTTGTGATTGGAGGAGTTGTGGCTGTGCCCATGGT GCTCAGTGCCATGGGCTTCACTGCGGCGGGAATCGCCTCGTCCTCCATAGCAGCCAAGATGATGTCCGCG GCGGCCATTGCCAATGGGGGTGGAGTTGCCTCGGGCAGCCTTGTGGCTACTCTGCAGTCACTGGGAGCAA CTGGACTCTCCGGATTGACCAAGTTCATCCTGGGCTCCATTGGGTCTGCCATTGCGGCTGTCATTGCGAG GTTCTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201952 protein sequence
Red=Cloning site Green=Tags(s) MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSA AAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005532 |
ORF Size | 357 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005532.5 |
RefSeq Size | 672 bp |
RefSeq ORF | 360 bp |
Locus ID | 3429 |
UniProt ID | P40305 |
Cytogenetics | 14q32.12 |
Protein Families | Transmembrane |
MW | 11.3 kDa |
Gene Summary | Probable adapter protein involved in different biological processes (PubMed:22427340, PubMed:27194766). Part of the signaling pathways that lead to apoptosis (PubMed:18330707, PubMed:27673746, PubMed:24970806). Involved in type-I interferon-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9 (PubMed:18330707, PubMed:27673746). Also functions in TNFSF10-induced apoptosis (PubMed:24970806). May also have a function in the nucleus, where it may be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors (PubMed:22427340). May thereby play a role in the vascular response to injury (By similarity). In the innate immune response, has an antiviral activity towards hepatitis C virus/HCV (PubMed:27194766, PubMed:27777077). May prevent the replication of the virus by recruiting both the hepatitis C virus non-structural protein 5A/NS5A and the ubiquitination machinery via SKP2, promoting the ubiquitin-mediated proteasomal degradation of NS5A (PubMed:27194766, PubMed:27777077).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201952L1 | Lenti ORF clone of Human interferon, alpha-inducible protein 27 (IFI27), transcript variant 2, Myc-DDK-tagged |
USD 450.00 |
|
RC201952L2 | Lenti ORF clone of Human interferon, alpha-inducible protein 27 (IFI27), transcript variant 2, mGFP tagged |
USD 450.00 |
|
RC201952L3 | Lenti ORF clone of Human interferon, alpha-inducible protein 27 (IFI27), transcript variant 2, Myc-DDK-tagged |
USD 450.00 |
|
RC201952L4 | Lenti ORF clone of Human interferon, alpha-inducible protein 27 (IFI27), transcript variant 2, mGFP tagged |
USD 450.00 |
|
RG201952 | IFI27 (tGFP-tagged) - Human interferon, alpha-inducible protein 27 (IFI27), transcript variant 2 |
USD 350.00 |
|
SC116713 | IFI27 (untagged)-Human interferon, alpha-inducible protein 27 (IFI27), transcript variant 2 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review