Aconitase 1(ACO1) (NM_002197) Human Tagged ORF Clone

CAT#: RC201857

ACO1 (Myc-DDK-tagged)-Human aconitase 1, soluble (ACO1)

Clone Modification / Custom Cloning Service

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Aconitase 1(ACO1) (NM_002197) Human Tagged ORF Clone
Symbol ACO1
Synonyms ACONS; HEL60; IREB1; IREBP; IREBP1; IRP1
Vector pCMV6-Entry
Sequence Data
>RC201857 representing NM_002197
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAACCCATTCGCACACCTTGCTGAGCCATTGGATCCTGTACAACCAGGAAAGAAATTCTTCAATT
TGAATAAATTGGAGGATTCAAGATATGGGCGCTTACCATTTTCGATCAGAGTTCTTCTGGAAGCAGCCAT
TCGGAATTGTGATGAGTTTTTGGTGAAGAAACAGGATATTGAAAATATTCTACATTGGAATGTCACGCAG
CACAAGAACATAGAAGTGCCATTTAAGCCTGCTCGTGTCATCCTGCAGGACTTTACGGGTGTGCCCGCTG
TGGTTGACTTTGCTGCAATGCGTGATGCTGTGAAAAAGTTAGGAGGAGATCCAGAGAAAATAAACCCTGT
CTGCCCTGCTGATCTTGTAATAGATCATTCCATCCAGGTTGATTTCAACAGAAGGGCAGACAGTTTACAG
AAGAATCAAGACCTGGAATTTGAAAGAAATAGAGAGCGATTTGAATTTTTAAAGTGGGGTTCCCAGGCTT
TTCACAACATGCGGATTATTCCCCCTGGCTCAGGAATCATCCACCAGGTGAATTTGGAATATTTGGCAAG
AGTGGTATTTGATCAGGATGGATATTATTACCCAGACAGCCTCGTGGGCACAGACTCGCACACTACCATG
ATTGATGGCTTGGGCATTCTTGGTTGGGGTGTCGGTGGTATTGAAGCAGAAGCTGTCATGCTGGGTCAGC
CAATCAGTATGGTGCTTCCTCAGGTGATTGGCTACAGGCTGATGGGGAAGCCCCACCCTCTGGTAACATC
CACTGACATCGTGCTCACCATTACCAAGCACCTCCGCCAGGTTGGGGTAGTGGGCAAATTTGTCGAGTTC
TTCGGGCCTGGAGTAGCCCAGTTGTCCATTGCTGACCGAGCTACGATTGCTAACATGTGTCCAGAGTACG
GAGCAACTGCTGCCTTTTTCCCAGTTGATGAAGTTAGTATCACGTACCTGGTGCAAACAGGTCGTGATGA
AGAAAAATTAAAGTATATTAAAAAATATCTTCAGGCTGTAGGAATGTTTCGAGATTTCAATGACCCTTCT
CAAGACCCAGACTTCACCCAGGTTGTGGAATTAGATTTGAAAACAGTAGTGCCTTGCTGTAGTGGACCCA
AAAGGCCTCAGGACAAAGTTGCTGTGTCCGACATGAAAAAGGACTTTGAGAGCTGCCTTGGAGCCAAGCA
AGGATTTAAAGGATTCCAAGTTGCTCCTGAACATCATAATGACCATAAGACCTTTATCTATGATAACACT
GAATTCACCCTTGCTCATGGTTCTGTGGTCATTGCTGCCATTACTAGCTGCACAAACACCAGTAATCCGT
CTGTGATGTTAGGGGCAGGATTGTTAGCAAAGAAAGCTGTGGATGCTGGCCTGAACGTGATGCCTTACAT
CAAAACTAGCCTGTCTCCTGGGAGTGGCGTGGTCACCTACTACCTACAAGAAAGCGGAGTCATGCCTTAT
CTGTCTCAGCTTGGGTTTGACGTGGTGGGCTATGGCTGCATGACCTGCATTGGCAACAGTGGGCCTTTAC
CTGAACCTGTGGTAGAAGCCATCACACAGGGAGACCTTGTAGCTGTTGGAGTACTATCTGGAAACAGGAA
TTTTGAAGGTCGAGTTCACCCCAACACCCGGGCCAACTATTTAGCCTCTCCCCCCTTAGTAATAGCATAT
GCAATTGCTGGAACCATCAGAATCGACTTTGAGAAAGAGCCATTGGGAGTAAATGCAAAGGGACAGCAGG
TATTTCTGAAAGATATCTGGCCGACTAGAGACGAGATCCAGGCAGTGGAGCGTCAGTATGTCATCCCGGG
GATGTTTAAGGAAGTCTATCAGAAAATAGAGACTGTGAATGAAAGCTGGAATGCCTTAGCAACCCCATCA
GATAAGCTGTTTTTCTGGAATTCCAAATCTACGTATATCAAATCACCACCATTCTTTGAAAACCTGACTT
TGGATCTTCAGCCCCCTAAATCTATAGTGGATGCCTATGTGCTGCTAAATTTGGGAGATTCGGTAACAAC
TGACCACATCTCCCCAGCTGGAAATATTGCAAGAAACAGTCCTGCTGCTCGCTACTTAACTAACAGAGGC
CTAACTCCACGAGAATTCAACTCCTATGGCTCCCGCCGAGGTAATGACGCCGTCATGGCACGGGGAACAT
TTGCCAACATTCGCTTGTTAAACAGATTTTTGAACAAGCAGGCACCACAGACTATCCATCTGCCTTCTGG
GGAAATCCTTGATGTGTTTGATGCTGCTGAGCGGTACCAGCAGGCAGGCCTTCCCCTGATCGTTCTGGCT
GGCAAAGAGTACGGTGCAGGCAGCTCCCGAGACTGGGCAGCTAAGGGCCCTTTCCTGCTGGGAATCAAAG
CCGTCCTGGCCGAGAGCTACGAGCGCATTCACCGCAGTAACCTGGTTGGGATGGGTGTGATCCCACTTGA
ATATCTCCCTGGTGAGAATGCAGATGCCCTGGGGCTCACAGGGCAAGAACGATACACTATCATTATTCCA
GAAAACCTCAAACCACAAATGAAAGTCCAGGTCAAGCTGGATACTGGCAAGACCTTCCAGGCTGTCATGA
GGTTTGACACTGATGTGGAGCTCACTTATTTCCTCAACGGGGGCATCCTCAACTACATGATCCGCAAGAT
GGCCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201857 representing NM_002197
Red=Cloning site Green=Tags(s)

MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQ
HKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQ
KNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTM
IDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEF
FGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPS
QDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNT
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPY
LSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAY
AIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPS
DKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRG
LTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLA
GKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIP
ENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002197
ORF Size 2667 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002197.1, NM_002197.2, NP_002188
RefSeq Size 3498
RefSeq ORF 2670
Locus ID 48
Cytogenetics 9p21.1
Domains Aconitase_C, aconitase
Protein Families Druggable Genome
Protein Pathways Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways
MW 98.2 kDa
Gene Summary The protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jan 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)