Aconitase 1 (ACO1) (NM_002197) Human Tagged ORF Clone

CAT#: RC201857

Reviews ()
Write a review

ACO1 (Myc-DDK-tagged)-Human aconitase 1, soluble (ACO1)



  "NM_002197" in other vectors (7)

USD 750.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Aconitase 1 (ACO1) (NM_002197) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ACO1
Synonyms ACONS; HEL60; IREB1; IREBP; IREBP1; IRP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201857 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAACCCATTCGCACACCTTGCTGAGCCATTGGATCCTGTACAACCAGGAAAGAAATTCTTCAATT
TGAATAAATTGGAGGATTCAAGATATGGGCGCTTACCATTTTCGATCAGAGTTCTTCTGGAAGCAGCCAT
TCGGAATTGTGATGAGTTTTTGGTGAAGAAACAGGATATTGAAAATATTCTACATTGGAATGTCACGCAG
CACAAGAACATAGAAGTGCCATTTAAGCCTGCTCGTGTCATCCTGCAGGACTTTACGGGTGTGCCCGCTG
TGGTTGACTTTGCTGCAATGCGTGATGCTGTGAAAAAGTTAGGAGGAGATCCAGAGAAAATAAACCCTGT
CTGCCCTGCTGATCTTGTAATAGATCATTCCATCCAGGTTGATTTCAACAGAAGGGCAGACAGTTTACAG
AAGAATCAAGACCTGGAATTTGAAAGAAATAGAGAGCGATTTGAATTTTTAAAGTGGGGTTCCCAGGCTT
TTCACAACATGCGGATTATTCCCCCTGGCTCAGGAATCATCCACCAGGTGAATTTGGAATATTTGGCAAG
AGTGGTATTTGATCAGGATGGATATTATTACCCAGACAGCCTCGTGGGCACAGACTCGCACACTACCATG
ATTGATGGCTTGGGCATTCTTGGTTGGGGTGTCGGTGGTATTGAAGCAGAAGCTGTCATGCTGGGTCAGC
CAATCAGTATGGTGCTTCCTCAGGTGATTGGCTACAGGCTGATGGGGAAGCCCCACCCTCTGGTAACATC
CACTGACATCGTGCTCACCATTACCAAGCACCTCCGCCAGGTTGGGGTAGTGGGCAAATTTGTCGAGTTC
TTCGGGCCTGGAGTAGCCCAGTTGTCCATTGCTGACCGAGCTACGATTGCTAACATGTGTCCAGAGTACG
GAGCAACTGCTGCCTTTTTCCCAGTTGATGAAGTTAGTATCACGTACCTGGTGCAAACAGGTCGTGATGA
AGAAAAATTAAAGTATATTAAAAAATATCTTCAGGCTGTAGGAATGTTTCGAGATTTCAATGACCCTTCT
CAAGACCCAGACTTCACCCAGGTTGTGGAATTAGATTTGAAAACAGTAGTGCCTTGCTGTAGTGGACCCA
AAAGGCCTCAGGACAAAGTTGCTGTGTCCGACATGAAAAAGGACTTTGAGAGCTGCCTTGGAGCCAAGCA
AGGATTTAAAGGATTCCAAGTTGCTCCTGAACATCATAATGACCATAAGACCTTTATCTATGATAACACT
GAATTCACCCTTGCTCATGGTTCTGTGGTCATTGCTGCCATTACTAGCTGCACAAACACCAGTAATCCGT
CTGTGATGTTAGGGGCAGGATTGTTAGCAAAGAAAGCTGTGGATGCTGGCCTGAACGTGATGCCTTACAT
CAAAACTAGCCTGTCTCCTGGGAGTGGCGTGGTCACCTACTACCTACAAGAAAGCGGAGTCATGCCTTAT
CTGTCTCAGCTTGGGTTTGACGTGGTGGGCTATGGCTGCATGACCTGCATTGGCAACAGTGGGCCTTTAC
CTGAACCTGTGGTAGAAGCCATCACACAGGGAGACCTTGTAGCTGTTGGAGTACTATCTGGAAACAGGAA
TTTTGAAGGTCGAGTTCACCCCAACACCCGGGCCAACTATTTAGCCTCTCCCCCCTTAGTAATAGCATAT
GCAATTGCTGGAACCATCAGAATCGACTTTGAGAAAGAGCCATTGGGAGTAAATGCAAAGGGACAGCAGG
TATTTCTGAAAGATATCTGGCCGACTAGAGACGAGATCCAGGCAGTGGAGCGTCAGTATGTCATCCCGGG
GATGTTTAAGGAAGTCTATCAGAAAATAGAGACTGTGAATGAAAGCTGGAATGCCTTAGCAACCCCATCA
GATAAGCTGTTTTTCTGGAATTCCAAATCTACGTATATCAAATCACCACCATTCTTTGAAAACCTGACTT
TGGATCTTCAGCCCCCTAAATCTATAGTGGATGCCTATGTGCTGCTAAATTTGGGAGATTCGGTAACAAC
TGACCACATCTCCCCAGCTGGAAATATTGCAAGAAACAGTCCTGCTGCTCGCTACTTAACTAACAGAGGC
CTAACTCCACGAGAATTCAACTCCTATGGCTCCCGCCGAGGTAATGACGCCGTCATGGCACGGGGAACAT
TTGCCAACATTCGCTTGTTAAACAGATTTTTGAACAAGCAGGCACCACAGACTATCCATCTGCCTTCTGG
GGAAATCCTTGATGTGTTTGATGCTGCTGAGCGGTACCAGCAGGCAGGCCTTCCCCTGATCGTTCTGGCT
GGCAAAGAGTACGGTGCAGGCAGCTCCCGAGACTGGGCAGCTAAGGGCCCTTTCCTGCTGGGAATCAAAG
CCGTCCTGGCCGAGAGCTACGAGCGCATTCACCGCAGTAACCTGGTTGGGATGGGTGTGATCCCACTTGA
ATATCTCCCTGGTGAGAATGCAGATGCCCTGGGGCTCACAGGGCAAGAACGATACACTATCATTATTCCA
GAAAACCTCAAACCACAAATGAAAGTCCAGGTCAAGCTGGATACTGGCAAGACCTTCCAGGCTGTCATGA
GGTTTGACACTGATGTGGAGCTCACTTATTTCCTCAACGGGGGCATCCTCAACTACATGATCCGCAAGAT
GGCCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201857 protein sequence
Red=Cloning site Green=Tags(s)

MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQ
HKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVIDHSIQVDFNRRADSLQ
KNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTM
IDGLGILGWGVGGIEAEAVMLGQPISMVLPQVIGYRLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEF
FGPGVAQLSIADRATIANMCPEYGATAAFFPVDEVSITYLVQTGRDEEKLKYIKKYLQAVGMFRDFNDPS
QDPDFTQVVELDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPEHHNDHKTFIYDNT
EFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVMPYIKTSLSPGSGVVTYYLQESGVMPY
LSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAY
AIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVERQYVIPGMFKEVYQKIETVNESWNALATPS
DKLFFWNSKSTYIKSPPFFENLTLDLQPPKSIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRG
LTPREFNSYGSRRGNDAVMARGTFANIRLLNRFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLA
GKEYGAGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIP
ENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002197
ORF Size 2667 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002197.1, NM_002197.2, NP_002188.1
RefSeq Size 3561 bp
RefSeq ORF 2670 bp
Locus ID 48
Cytogenetics 9p21.1
Domains Aconitase_C, aconitase
Protein Families Druggable Genome
Protein Pathways Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways
MW 98.4 kDa
Gene Summary The protein encoded by this gene is a bifunctional, cytosolic protein that functions as an essential enzyme in the TCA cycle and interacts with mRNA to control the levels of iron inside cells. When cellular iron levels are high, this protein binds to a 4Fe-4S cluster and functions as an aconitase. Aconitases are iron-sulfur proteins that function to catalyze the conversion of citrate to isocitrate. When cellular iron levels are low, the protein binds to iron-responsive elements (IREs), which are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. When the protein binds to IRE, it results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degraded transferrin receptor mRNA. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jan 2014]

Citations (1)

Other Versions

Other products for "ACO1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Anti-ACO1 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools