RSK3 (RPS6KA2) (NM_021135) Human Tagged ORF Clone

CAT#: RC201835

Reviews ()
Write a review

RPS6KA2 (Myc-DDK-tagged)-Human ribosomal protein S6 kinase, 90kDa, polypeptide 2 (RPS6KA2), transcript variant 1



  "NM_021135" in other vectors (8)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RPS6KA2
Synonyms HU-2; MAPKAPK1C; p90-RSK3; p90RSK2; pp90RSK3; RSK; RSK3; S6K-alpha; S6K-alpha2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201835 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTGAGCATGAAGAAGTTCGCCGTGCGCAGGTTCTTCTCTGTGTACCTGCGCAGGAAGTCGCGCT
CCAAGAGCTCCAGCCTGAGCCGGCTCGAGGAAGAAGGTGTCGTGAAGGAGATAGACATCAGCCATCATGT
GAAGGAGGGCTTTGAGAAGGCAGATCCTTCCCAGTTTGAGCTGCTGAAGGTTTTAGGACAAGGATCCTAT
GGAAAGGTGTTCCTGGTGAGGAAGGTGAAGGGGTCCGACGCTGGGCAGCTCTACGCCATGAAGGTCCTTA
AGAAAGCCACCCTAAAAGTTCGGGACCGAGTGAGATCGAAGATGGAGAGAGACATCTTGGCAGAAGTGAA
TCACCCCTTCATTGTGAAGCTTCATTATGCCTTTCAGACGGAAGGAAAGCTCTACCTGATCCTGGACTTC
CTGCGGGGAGGGGACCTCTTCACCCGGCTCTCCAAAGAGGTCATGTTCACGGAGGAGGATGTCAAGTTCT
ACCTGGCTGAGCTGGCCTTGGCTTTAGACCATCTCCACAGCCTGGGGATCATCTACAGAGATCTGAAGCC
TGAGAACATCCTCCTGGATGAAGAGGGGCACATTAAGATCACAGATTTCGGCCTGAGTAAGGAGGCCATT
GACCACGACAAGAGAGCGTACTCCTTCTGCGGGACGATCGAGTACATGGCGCCCGAGGTGGTGAACCGGC
GAGGACACACGCAGAGTGCCGACTGGTGGTCCTTCGGCGTGCTCATGTTTGAGATGCTCACGGGGTCCCT
GCCGTTCCAGGGGAAGGACAGGAAGGAGACCATGGCTCTCATCCTCAAAGCCAAGCTGGGGATGCCGCAG
TTCCTCAGTGGGGAGGCACAGAGTTTGCTGCGAGCTCTCTTCAAACGGAACCCCTGCAACCGGCTGGGTG
CTGGCATTGACGGAGTGGAGGAAATTAAGCGCCATCCCTTCTTTGTGACCATAGACTGGAACACGCTGTA
CCGGAAGGAGATCAAGCCACCGTTCAAACCAGCAGTGGGCAGGCCTGAGGACACCTTCCACTTTGACCCC
GAGTTCACAGCGCGGACGCCCACAGACTCTCCTGGCGTCCCCCCGAGTGCAAACGCTCATCACCTGTTTA
GAGGATTCAGCTTTGTGGCCTCAAGCCTGATCCAGGAGCCCTCACAGCAAGATCTGCACAAAGTCCCAGT
TCACCCAATCGTGCAGCAGTTACACGGGAACAACATCCACTTCACCGATGGCTACGAGATCAAGGAGGAC
ATCGGGGTGGGCTCCTACTCAGTGTGCAAGCGATGTGTGCATAAAGCCACAGACACCGAGTATGCCGTGA
AGATCATTGATAAGAGCAAGAGAGACCCCTCGGAAGAGATTGAGATCCTCCTGCGGTACGGCCAGCACCC
GAACATCATCACCCTCAAGGATGTCTATGATGATGGCAAGTTTGTGTACCTGGTAATGGAGCTGATGCGT
GGTGGGGAGCTCCTGGACCGCATCCTCCGGCAGAGATACTTCTCGGAGCGCGAAGCCAGTGACGTCCTGT
GCACCATCACCAAGACCATGGACTACCTCCATTCCCAGGGGGTTGTTCATCGAGACCTGAAGCCGAGTAA
CATCCTGTACAGGGATGAGTCGGGGAGCCCAGAATCCATCCGAGTCTGCGACTTCGGCTTTGCCAAGCAG
CTGCGCGCGGGGAACGGGCTGCTCATGACACCCTGCTACACGGCCAATTTCGTGGCCCCGGAGGTCCTGA
AGCGTCAAGGCTATGATGCGGCGTGTGACATCTGGAGTTTGGGGATCCTGTTGTACACCATGCTGGCAGG
ATTTACCCCTTTTGCAAATGGGCCAGACGATACCCCTGAGGAGATTCTGGCGCGGATCGGCAGTGGGAAG
TATGCCCTTTCTGGGGGAAACTGGGACTCGATATCTGACGCAGCTAAAGACGTCGTGTCCAAGATGCTCC
ACGTGGACCCTCATCAGCGCCTGACGGCGATGCAAGTGCTCAAACACCCGTGGGTGGTCAACAGAGAGTA
CCTGTCCCCAAACCAGCTCAGCCGACAGGACGTGCACCTGGTGAAGGGCGCGATGGCCGCCACCTACTTT
GCTCTAAACAGAACACCTCAGGCCCCGCGGCTGGAGCCCGTGCTGTCGTCCAACCTGGCTCAGCGCAGAG
GCATGAAGAGACTCACGTCCACGCGGTTG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC201835 protein sequence
Red=Cloning site Green=Tags(s)

MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFELLKVLGQGSY
GKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDF
LRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAI
DHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQ
FLSGEAQSLLRALFKRNPCNRLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDP
EFTARTPTDSPGVPPSANAHHLFRGFSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKED
IGVGSYSVCKRCVHKATDTEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKFVYLVMELMR
GGELLDRILRQRYFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILYRDESGSPESIRVCDFGFAKQ
LRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGILLYTMLAGFTPFANGPDDTPEEILARIGSGK
YALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYF
ALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021135
ORF Size 2199 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021135.3
RefSeq Size 5817 bp
RefSeq ORF 2202 bp
Locus ID 6196
UniProt ID Q15349
Cytogenetics 6q27
Domains pkinase, S_TK_X, TyrKc, PDZ, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Long-term potentiation, MAPK signaling pathway, mTOR signaling pathway, Neurotrophin signaling pathway, Oocyte meiosis, Progesterone-mediated oocyte maturation
MW 83.2 kDa
Gene Summary This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains two non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternative splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jan 2016]

Other Versions

Other products for "RPS6KA2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


RPS6KA2 mouse monoclonal antibody,clone OTI2H3
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.