PFKFB4 (NM_004567) Human Tagged ORF Clone

CAT#: RC201573

Reviews ()
Write a review

PFKFB4 (Myc-DDK-tagged)-Human 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 (PFKFB4)



  "NM_004567" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "PFKFB4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PFKFB4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201573 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCCCCACGGGAATTGACACAGAACCCCCTGAAGAAGATCTGGATGCCATACAGCAATGGGCGGC
CCGCTCTGCACGCTTGCCAGCGCGGTGTGTGCATGACCAACTGCCCAACTCTCATTGTCATGGTGGGCCT
GCCCGCCAGGGGCAAGACCTACATCTCCAAGAAGCTGACTCGATACCTGAACTGGATTGGTGTGCCCACT
CGGGAGTTCAATGTTGGCCAGTATCGCCGGGACGTGGTCAAGACCTACAAATCTTTTGAATTTTTTCTCC
CCGACAATGAAGAGGGCCTGAAAATCAGGAAGCAGTGTGCCCTGGCAGCCCTCCGTGACGTCCGGCGGTT
CCTTAGTGAGGAGGGGGGACATGTGGCGGTTTTTGATGCCACAAACACCACCCGAGAACGGAGAGCGACC
ATCTTTAATTTTGGAGAACAGAATGGCTACAAGACCTTTTTTGTCGAGTCCATCTGTGTGGATCCTGAGG
TCATAGCTGCCAACATCGTGCAAGTGAAACTGGGCAGCCCTGACTATGTCAACCGCGACAGTGATGAGGC
TACGGAGGACTTCATGAGGCGCATTGAGTGCTATGAGAACTCCTACGAGTCGCTAGATGAGGACCTGGAT
AGGGACCTGTCCTATATCAAGATCATGGATGTGGGCCAGAGCTACGTGGTGAACCGTGTGGCTGACCACA
TCCAGAGCCGCATCGTATATTACCTCATGAACATCCACGTGACCCCCCGCTCCATCTACCTCTGCCGGCA
CGGGGAGAGCGAGCTCAACCTCAAGGGCCGGATTGGCGGGGACCCAGGACTGTCCCCTCGGGGCAGGGAG
TTTGCCAAGAGTCTAGCCCAGTTCATCAGTGACCAAAATATCAAGGATCTGAAGGTCTGGACAAGCCAGA
TGAAGAGGACAATCCAGACGGCTGAGGCACTGGGTGTGCCCTATGAACAGTGGAAGGTCCTCAACGAGAT
CGATGCGGGCGTCTGTGAGGAAATGACCTACGAGGAAATTCAGGATAATTATCCACTGGAGTTCGCCCTG
CGGGACCAGGACAAGTACCGGTACCGGTACCCTAAAGGGGAGTCCTACGAGGACCTGGTCCAGAGACTGG
AGCCTGTCATCATGGAGCTGGAGAGGCAAGAGAATGTGCTGGTCATCTGCCACCAGGCTGTGATGCGCTG
CCTGCTGGCCTACTTCCTCGACAAGGCAGCAGAACAGCTGCCCTACCTCAAGTGTCCGCTGCACACAGTC
CTGAAGCTGACTCCTGTGGCATATGGTTGTAAAGTGGAGTCCATATTCCTGAACGTGGCTGCTGTGAACA
CGCACCGGGACAGGCCTCAGAACGTGGACATCTCAAGACCTCCAGAGGAAGCCCTTGTCACGGTGCCTGC
TCACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201573 protein sequence
Red=Cloning site Green=Tags(s)

MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLTRYLNWIGVPT
REFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSEEGGHVAVFDATNTTRERRAT
IFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLD
RDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGRE
FAKSLAQFISDQNIKDLKVWTSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFAL
RDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004567
ORF Size 1407 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004567.4
RefSeq Size 3503 bp
RefSeq ORF 1410 bp
Locus ID 5210
UniProt ID Q16877
Cytogenetics 3p21.31
Domains PGAM, 6PF2K
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism
MW 54 kDa
Gene Summary The protein encoded by this gene is one of four bifunctional kinase/phosphatases that regulate the concentration of the glycolytic byproduct fructose-2,6-bisphosphate (F2,6BP). The encoded protein is highly expressed in cancer cells and is induced by hypoxia. This protein is essential to the survival of cancer cells under conditions of hypoxia, because it increases the amount of F2,6BP and ATP at a time when the cell cannot produce much of them. This finding suggests that this protein may be a good target for disruption in cancer cells, hopefully imperiling their survival. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.