HSPC210 (GSKIP) (NM_016472) Human Tagged ORF Clone

CAT#: RC201493

GSKIP (Myc-DDK-tagged)-Human chromosome 14 open reading frame 129 (C14orf129)

Product Images

Circular map for RC201493

• 

  Western blot validation of overexpression lysate (Cat# LY413970) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201493 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified GSKIP protein (Cat# TP301493). The protein was produced from HEK293T cells transfected with GSKIP cDNA clone (Cat# RC201493) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HSPC210
• Synonyms: C14orf129; HSPC210
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201493 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAAACAGACTGTAATCCCATGGAGCTAAGCAGTATGTCAGGATTTGAAGAAGGTTCAGAGCTGAACG
  GTTTTGAAGGAACTGACATGAAAGACATGAGGCTCGAAGCTGAAGCAGTTGTAAATGATGTTCTCTTTGC
  TGTTAACAACATGTTTGTCTCGAAAAGCCTGCGGTGTGCGGATGATGTGGCCTATATCAATGTGGAAACA
  AAGGAAAGAAACAGATATTGCCTAGAACTCACTGAAGCAGGGCTCAAGGTGGTAGGCTATGCTTTTGACC
  AGGTAGATGATCATTTACAGACTCCCTACCATGAAACAGTCTACTCCTTGTTGGATACACTCAGCCCCGC
  CTACCGAGAAGCATTTGGAAACGCACTGCTTCAAAGACTGGAAGCTTTGAAAAGAGATGGACAGTCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201493 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVET
  KERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_016472
• ORF Size: 417 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_016472.5
• RefSeq Size: 2251 bp
• RefSeq ORF: 420 bp
• Locus ID: 51527
• UniProt ID: Q9P0R6
• Cytogenetics: 14q32.2
• MW: 15.6 kDa
• Gene Summary: This gene encodes a protein that is involved as a negative regulator of GSK3-beta in the Wnt signaling pathway. The encoded protein may play a role in the retinoic acid signaling pathway by regulating the functional interactions between GSK3-beta, beta-catenin and cyclin D1, and it regulates the beta-catenin/N-cadherin pool. The encoded protein contains a GSK3-beta interacting domain (GID) in its C-terminus, which is similar to the GID of Axin. The protein also contains an evolutionarily conserved RII-binding domain, which facilitates binding with protein kinase-A and GSK3-beta, enabling its role as an A-kinase anchoring protein. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]