AP2M1 (NM_001025205) Human Tagged ORF Clone

CAT#: RC201377

Reviews ()
Write a review

AP2M1 (Myc-DDK-tagged)-Human adaptor-related protein complex 2, mu 1 subunit (AP2M1), transcript variant 2



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Other products for "AP2M1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AP2M1
Synonyms AP50; CLAPM1; MRD60; mu2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201377 representing NM_001025205
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGGAGGCTTATTCATCTATAATCACAAGGGGGAGGTGCTCATCTCCCGAGTCTACCGAGATGACA
TCGGGAGGAACGCAGTGGATGCCTTTCGGGTCAATGTTATCCATGCCCGGCAGCAGGTGCGCAGCCCCGT
CACCAACATTGCTCGCACCAGCTTCTTCCACGTTAAGCGGTCCAACATTTGGCTGGCAGCAGTCACCAAG
CAGAATGTCAACGCTGCCATGGTCTTCGAATTCCTCTATAAGATGTGTGACGTGATGGCTGCCTACTTTG
GCAAGATCAGCGAGGAAAACATCAAGAACAATTTTGTGCTCATATATGAGCTGCTGGATGAGATTCTAGA
CTTTGGCTACCCACAGAATTCCGAGACAGGCGCGCTGAAAACCTTCATCACGCAGCAGGGCATCAAGAGT
CAGCATCAGACAAAAGAAGAGCAGTCACAGATCACCAGCCAGGTAACTGGGCAGATTGGCTGGCGGCGAG
AGGGTATCAAGTATCGTCGGAATGAGCTCTTCCTGGATGTGCTGGAGAGTGTGAACCTGCTCATGTCCCC
ACAAGGGCAGGTGCTGAGTGCCCATGTGTCGGGCCGGGTGGTGATGAAGAGCTACCTGAGTGGCATGCCT
GAATGCAAGTTTGGGATGAATGACAAGATTGTTATTGAAAAGCAGGGCAAAGGCACAGCTGATGAAACAA
GCAAGAGCGGGAAGCAATCAATTGCCATTGATGACTGCACCTTCCACCAGTGTGTGCGACTCAGCAAGTT
TGACTCTGAACGCAGCATCAGCTTTATCCCGCCAGATGGAGAGTTTGAGCTTATGAGGTATCGCACAACC
AAGGACATCATCCTTCCCTTCCGGGTGATCCCGCTAGTGCGAGAAGTGGGACGCACCAAACTGGAGGTCA
AGGTGGTCATCAAGTCCAACTTTAAACCCTCACTGCTGGCTCAGAAGATCGAGGTGAGGATCCCAACCCC
ACTGAACACAAGCGGGGTGCAGGTGATCTGCATGAAGGGGAAGGCCAAGTACAAGGCCAGCGAGAATGCC
ATCGTGTGGAAGATCAAGCGCATGGCAGGCATGAAGGAATCGCAGATCAGCGCAGAGATTGAGCTTCTGC
CTACCAACGACAAGAAGAAATGGGCTCGACCCCCCATTTCCATGAACTTTGAGGTGCCATTCGCGCCCTC
TGGCCTCAAGGTGCGCTACTTGAAGGTGTTTGAACCGAAGCTGAACTACAGCGACCATGATGTCATCAAA
TGGGTGCGCTACATTGGCCGCAGTGGCATTTATGAAACTCGCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201377 representing NM_001025205
Red=Cloning site Green=Tags(s)

MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTK
QNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKS
QHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMP
ECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTT
KDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENA
IVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001025205
ORF Size 1305 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001025205.1, NP_001020376.1
RefSeq Size 1952 bp
RefSeq ORF 1302 bp
Locus ID 1173
UniProt ID Q96CW1
Cytogenetics 3q27.1
Protein Families Druggable Genome
Protein Pathways Endocytosis, Huntington's disease
MW 49.2 kDa
Gene Summary This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.