NALP2 (NLRP2) (NM_017852) Human Tagged ORF Clone

CAT#: RC201357

Reviews ()
Write a review

NLRP2 (Myc-DDK-tagged)-Human NLR family, pyrin domain containing 2 (NLRP2), transcript variant 1



Reconstitution Protocol

USD 924.00

USD 1,386.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "NLRP2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NLRP2
Synonyms CLR19.9; NALP2; NBS1; PAN1; PYPAF2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201357 representing NM_017852
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTCTTCGGCGCAGATGGGCTTCAACCTGCAGGCTCTCCTGGAGCAGCTCAGCCAGGATGAGTTGA
GCAAGTTCAAGTATCTGATCACGACCTTCTCCCTGGCACACGAGCTCCAGAAGATCCCCCACAAGGAGGT
AGACAAGGCTGATGGGAAGCAACTGGTAGAAATCCTCACCACCCATTGTGACAGCTACTGGGTGGAGATG
GCGAGCCTCCAGGTCTTTGAAAAGATGCACCGAATGGATCTGTCTGAGAGAGCAAAGGATGAAGTCAGAG
AAGCAGCTTTGAAATCCTTTAATAAAAGGAAACCTCTATCATTAGGGATAACACGGAAAGAACGACCACC
TCTAGACGTGGACGAAATGCTGGAGCGCTTCAAAACAGAAGCACAAGCGTTTACAGAAACGAAAGGAAAT
GTCATCTGCCTGGGTAAAGAAGTCTTTAAAGGAAAAAAGCCAGACAAAGACAATAGGTGCAGGTATATAT
TGAAGACGAAGTTCCGGGAGATGTGGAAGAGCTGGCCTGGAGATAGCAAAGAGGTCCAGGTTATGGCTGA
GAGATACAAGATGCTGATCCCATTCAGCAACCCCAGGGTGCTTCCCGGGCCCTTCTCATACACGGTGGTG
CTGTATGGTCCTGCAGGCCTTGGGAAAACCACGCTGGCCCAGAAACTAATGCTAGACTGGGCAGAGGACA
ACCTCATCCACAAATTCAAATATGCGTTCTACCTCAGCTGCAGGGAGCTCAGCCGCCTGGGCCCGTGCAG
TTTTGCAGAGCTGGTCTTCAGGGACTGGCCTGAATTGCAGGATGACATTCCACACATCCTAGCCCAAGCA
CGGAAAATCTTGTTCGTGATTGACGGCTTTGATGAGCTGGGAGCCGCACCTGGGGCGCTGATCGAGGACA
TCTGCGGGGACTGGGAGAAGAAGAAGCCGGTGCCCGTCCTCCTGGGGAGTTTGCTGAACAGGGTGATGTT
ACCCAAGGCCGCCCTGCTGGTCACCACGCGGCCCAGGGCCCTGAGGGACCTCCGGATCCTGGCGGAGGAG
CCGATCTACATAAGGGTGGAGGGCTTCCTGGAGGAGGACAGGAGGGCCTATTTCCTGAGACACTTTGGAG
ACGAGGACCAAGCCATGCGTGCCTTTGAGCTAATGAGGAGCAACGCGGCCCTGTTCCAGCTGGGCTCGGC
CCCCGCGGTGTGCTGGATCGTGTGCACGACTCTGAAGCTGCAGATGGAGAAGGGGGAGGACCCGGTCCCC
ACCTGCCTCACCCGCACGGGGCTGTTCCTGCGTTTCCTCTGCAGCCGGTTCCCGCAGGGCGCACAGCTGC
GGGGCGCGCTGCGGACGCTGAGCCTCCTGGCCGCGCAGGGCCTGTGGGCGCAGACGTCCGTGCTTCACCG
AGAGGATCTGGAAAGGCTCGGGGTGCAGGAGTCCGACCTCCGTCTGTTCCTGGACGGAGACATCCTCCGC
CAGGACAGAGTCTCCAAAGGCTGCTACTCCTTCATCCACCTCAGCTTCCAGCAGTTTCTCACTGCCCTGT
TCTACACCCTGGAGAAGGAGGAGGAAGAGGATAGGGACGGCCACACCTGGGACATTGGGGACGTACAGAA
GCTGCTTTCCGGAGTAGAAAGACTCAGGAACCCCGACCTGATCCAAGCAGGCTACTACTCCTTTGGCCTC
GCTAACGAGAAGAGAGCCAAGGAGTTGGAGGCCACTTTTGGCTGCCGGATGTCACCGGACATCAAACAGG
AATTGCTGCGATGCGACATAAGTTGTAAGGGTGGACATTCAACGGTGACAGACCTGCAGGAGCTCCTCGG
CTGTCTGTACGAGTCTCAGGAGGAGGAGCTGGTGAAGGAGGTGATGGCTCAGTTCAAAGAAATATCCCTG
CACTTAAATGCAGTAGACGTTGTGCCATCTTCATTCTGCGTCAAGCACTGTCGAAACCTGCAGAAAATGT
CACTGCAGGTAATAAAGGAGAATCTCCCGGAGAATGTCACTGCGTCTGAATCAGACGCCGAGGTTGAGAG
ATCCCAGGATGATCAGCACATGCTTCCTTTCTGGACGGACCTTTGTTCCATATTTGGATCAAATAAGGAT
CTGATGGGTCTAGCAATCAATGATAGCTTTCTCAGTGCCTCCCTAGTAAGGATCCTGTGTGAACAAATAG
CCTCTGACACCTGTCATCTCCAGAGAGTGGTGTTCAAAAACATTTCCCCAGCTGATGCTCATCGGAACCT
CTGCCTAGCTCTTCGAGGTCACAAGACTGTAACGTATCTGACCCTTCAAGGCAATGACCAGGATGATATG
TTTCCCGCATTGTGTGAGGTCTTGAGACATCCAGAATGTAACCTGCGATATCTCGGGTTGGTGTCTTGTT
CCGCTACCACTCAGCAGTGGGCTGATCTCTCCTTGGCCCTTGAAGTCAACCAGTCCCTGACGTGCGTAAA
CCTCTCCGACAATGAGCTTCTGGATGAGGGTGCTAAGTTGCTGTACACAACTTTGAGACACCCCAAGTGC
TTTCTGCAGAGGTTGTCGTTGGAAAACTGTCACCTTACAGAAGCCAATTGCAAGGACCTTGCTGCTGTGT
TGGTTGTCAGCCGGGAGCTGACACACCTGTGCTTGGCCAAGAACCCCATTGGGAATACAGGGGTGAAGTT
TCTGTGTGAGGGCTTGAGGTACCCCGAGTGTAAACTGCAGACCTTGGTGCTTTGGAACTGCGACATAACT
AGCGATGGCTGCTGCGATCTCACAAAGCTTCTCCAAGAAAAATCAAGCCTGTTGTGTTTGGATCTGGGGC
TGAATCACATAGGAGTTAAGGGAATGAAGTTCCTGTGTGAGGCTTTGAGGAAACCACTGTGCAACTTGAG
ATGTCTGTGGTTGTGGGGATGTTCCATCCCTCCGTTCAGTTGTGAAGACCTCTGCTCTGCCCTCAGCTGC
AACCAGAGCCTCGTCACTCTGGACCTGGGTCAGAATCCCTTGGGGTCTAGTGGAGTGAAGATGCTGTTTG
AAACCTTGACATGTTCCAGTGGCACCCTCCGGACACTCAGGTTGAAAATAGATGACTTTAATGATGAACT
CAATAAGCTGCTGGAAGAAATAGAAGAAAAAAACCCACAACTGATTATTGATACTGAGAAACATCATCCC
TGGGCAGAAAGGCCTTCTTCTCATGACTTCATGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201357 representing NM_017852
Red=Cloning site Green=Tags(s)

MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEM
ASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGN
VICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVV
LYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQA
RKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE
PIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVP
TCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILR
QDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGL
ANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVMAQFKEISL
HLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKD
LMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDM
FPALCEVLRHPECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKC
FLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDIT
SDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSC
NQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHP
WAERPSSHDFMI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017852
ORF Size 3186 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017852.2
RefSeq Size 3531 bp
RefSeq ORF 3189 bp
Locus ID 55655
UniProt ID Q9NX02
Cytogenetics 19q13.42
Domains LRR, LRR_RI
MW 120.3 kDa
Gene Summary This gene is a member of the nucleotide-binding and leucine-rich repeat receptor (NLR) family, and is predicted to contain an N-terminal pyrin effector domain (PYD), a centrally-located nucleotide-binding and oligomerization domain (NACHT) and C-terminal leucine-rich repeats (LRR). Members of this gene family are thought to be important regulators of immune responses. This gene product interacts with components of the IkB kinase (IKK) complex, and can regulate both caspase-1 and NF-kB (nuclear factor kappa-light-chain-enhancer of activated B cells) activity. The pyrin domain is necessary and sufficient for suppression of NF-kB activity. An allelic variant (rs147585490) has been found that is incapable of blocking the transcriptional activity of NF-kB. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.