Suppressor of Fused (SUFU) (NM_016169) Human Tagged ORF Clone

CAT#: RC201021

Reviews ()
Write a review

SUFU (Myc-DDK-tagged)-Human suppressor of fused homolog (Drosophila) (SUFU), transcript variant 1



  "NM_016169" in other vectors (6)

Reconstitution Protocol

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "SUFU"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SUFU
Synonyms JBTS32; PRO1280; SUFUH; SUFUXL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201021 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGCTGCGGCCTAGCGGCGCCCCCGGCCCCACCGCGCCCCCGGCCCCTGGCCCGACTGCCCCCC
CGGCCTTCGCTTCGCTCTTTCCCCCGGGACTGCACGCCATCTACGGAGAGTGCCGCCGCCTTTACCCTGA
CCAGCCGAACCCGCTCCAGGTTACCGCTATCGTCAAGTACTGGTTGGGTGGCCCAGACCCCTTGGACTAT
GTTAGCATGTACAGGAATGTGGGGAGCCCTTCTGCTAACATCCCCGAGCACTGGCACTACATCAGCTTCG
GCCTGAGTGATCTCTATGGTGACAACAGAGTCCATGAGTTTACAGGAACAGATGGACCTAGTGGTTTTGG
CTTTGAGTTGACCTTTCGTCTGAAGAGAGAAACTGGGGAGTCTGCCCCACCAACATGGCCCGCAGAGTTA
ATGCAGGGCTTGGCACGATACGTGTTCCAGTCAGAGAACACCTTCTGCAGTGGGGACCATGTGTCCTGGC
ACAGCCCTTTGGATAACAGTGAGTCAAGAATTCAGCACATGCTGCTGACAGAGGACCCACAGATGCAGCC
CGTGCAGACACCCTTTGGGGTAGTTACCTTCCTCCAGATCGTTGGTGTCTGCACTGAAGAGCTACACTCA
GCCCAGCAGTGGAACGGGCAGGGCATCCTGGAGCTGCTGCGGACAGTGCCTATTGCTGGCGGCCCCTGGC
TGATAACTGACATGCGGAGGGGAGAGACCATATTTGAGATCGATCCACACCTGCAAGAGAGAGTTGACAA
AGGCATCGAGACAGATGGCTCCAACCTGAGTGGTGTCAGTGCCAAGTGTGCCTGGGATGACCTGAGCCGG
CCCCCCGAGGATGACGAGGACAGCCGGAGCATCTGCATCGGCACACAGCCCCGGCGACTCTCTGGCAAAG
ACACAGAGCAGATCCGGGAGACCCTGAGGAGAGGACTCGAGATCAACAGCAAACCTGTCCTTCCACCAAT
CAACCCTCAGCGGCAGAATGGCCTCGCCCACGACCGGGCCCCGAGCCGCAAAGACAGCCTGGAAAGTGAC
AGCTCCACGGCCATCATTCCCCATGAGCTGATTCGCACGCGGCAGCTTGAGAGCGTACATCTGAAATTCA
ACCAGGAGTCCGGAGCCCTCATTCCTCTCTGCCTAAGGGGCAGGCTCCTGCATGGACGGCACTTTACATA
TAAAAGTATCACAGGTGACATGGCCATCACGTTTGTCTCCACGGGAGTGGAAGGCGCCTTTGCCACTGAG
GAGCATCCTTACGCGGCTCATGGACCCTGGTTACAAATTCTGTTGACCGAAGAGTTTGTAGAGAAAATGT
TGGAGGATTTAGAAGATTTGACTTCTCCAGAGGAATTCAAACTTCCCAAAGAGTACAGCTGGCCTGAAAA
GAAGCTGAAGGTCTCCATCCTGCCTGACGTGGTGTTCGACAGTCCGCTACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201021 protein sequence
Red=Cloning site Green=Tags(s)

MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDY
VSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRETGESAPPTWPAEL
MQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLTEDPQMQPVQTPFGVVTFLQIVGVCTEELHS
AQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSR
PPEDDEDSRSICIGTQPRRLSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESD
SSTAIIPHELIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE
EHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSPLH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016169
ORF Size 1452 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016169.4
RefSeq Size 4994 bp
RefSeq ORF 1455 bp
Locus ID 51684
UniProt ID Q9UMX1
Cytogenetics 10q24.32
Domains SUFU
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Pathways in cancer
MW 53.9 kDa
Gene Summary The Hedgehog signaling pathway plays an important role in early human development. The pathway is a signaling cascade that plays a role in pattern formation and cellular proliferation during development. This gene encodes a negative regulator of the hedgehog signaling pathway. Defects in this gene are a cause of medulloblastoma. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.