BRCC36 (BRCC3) (NM_024332) Human Tagged ORF Clone

CAT#: RC200727

BRCC3 (Myc-DDK-tagged)-Human BRCA1/BRCA2-containing complex, subunit 3 (BRCC3), transcript variant 1

Product Images

Circular map for RC200727

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY BRCC3 (Cat# RC200727, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-BRCC3 (Cat# TA811409)(1:500). Positive lysates LY411291 (100ug) and LC411291 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY411291) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200727 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: BRCC36
• Synonyms: BRCC36; C6.1A; CXorf53
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200727 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGTGCAGGTGGTGCAGGCGGTGCAGGCGGTTCATCTCGAGTCTGACGCTTTCCTCGTTTGTCTCA
  ACCACGCTCTGAGCACAGAGAAGGAGGAAGTAATGGGGCTGTGCATAGGGGAGTTGAACGATGATACAAG
  GAGTGACTCCAAATTTGCATATACTGGAACTGAAATGCGCACAGTTGCTGAAAAGGTTGATGCCGTCAGA
  ATTGTTCACATTCATTCTGTCATCATCTTACGACGTTCTGATAAGAGGAAGGACCGAGTAGAAATTTCTC
  CAGAGCAGCTGTCTGCAGCTTCAACAGAGGCAGAGAGGTTGGCTGAACTGACAGGCCGCCCCATGAGAGT
  TGTGGGCTGGTATCATTCCCATCCTCATATAACTGTTTGGCCTTCACATGTTGATGTTCGCACACAAGCC
  ATGTACCAGATGATGGATCAAGGCTTTGTAGGACTTATTTTTTCCTGTTTCATAGAAGATAAGAACACAA
  AGACTGGCCGGGTACTCTACACTTGCTTCCAATCCATACAGGCCCAAAAGAGTTCAGAGTCCCTTCATGG
  TCCACGAGACTTCTGGAGCTCCAGCCAGCACATCTCCATTGAGGGCCAGAAGGAAGAGGAAAGGTATGAG
  AGAATCGAAATCCCAATCCATATTGTACCTCATGTCACTATCGGGAAAGTGTGCCTTGAATCAGCAGTAG
  AGCTGCCCAAGATCCTGTGCCAGGAGGAGCAGGATGCGTATAGGAGGATCCACAGCCTTACACATCTGGA
  CTCAGTAACCAAGATCCATAATGGCTCAGTGTTTACCAAGAATCTGTGCAGTCAGATGTCGGCAGTCAGC
  GGGCCTCTCCTACAGTGGTTGGAGGACAGACTGGAGCAAAACCAACAGCATTTGCAGGAATTACAACAAG
  AAAAGGAAGAGCTTATGCAAGAACTTTCTTCTCTAGAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200727 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVR
  IVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQA
  MYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYE
  RIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVS
  GPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_024332
• ORF Size: 948 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_024332.3, NP_077308.1
• RefSeq Size: 2952 bp
• RefSeq ORF: 951 bp
• Locus ID: 79184
• UniProt ID: P46736
• Cytogenetics: Xq28
• Domains: JAB_MPN
• Protein Families: Druggable Genome, Protease
• MW: 36.1 kDa
• Gene Summary: This gene encodes a subunit of the BRCA1-BRCA2-containing complex (BRCC), which is an E3 ubiquitin ligase. This complex plays a role in the DNA damage response, where it is responsible for the stable accumulation of BRCA1 at DNA break sites. The component encoded by this gene can specifically cleave Lys 63-linked polyubiquitin chains, and it regulates the abundance of these polyubiquitin chains in chromatin. The loss of this gene results in abnormal angiogenesis and is associated with syndromic moyamoya, a cerebrovascular angiopathy. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 5. [provided by RefSeq, Jun 2011]