DAD1 (NM_001344) Human Tagged ORF Clone
CAT#: RC200623
- TrueORF®
DAD1 (Myc-DDK-tagged)-Human defender against cell death 1 (DAD1)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_001344" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | DAD1 |
Synonyms | OST2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200623 representing NM_001344
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGGCGTCGGTAGTGTCTGTCATTTCGCGGTTCTTAGAAGAGTACTTGAGCTCCACTCCGCAGCGTC TGAAGTTGCTGGACGCGTACCTGCTGTATATACTGCTGACCGGGGCGCTGCAGTTCGGTTACTGTCTCCT CGTGGGGACCTTCCCCTTCAACTCTTTTCTCTCGGGCTTCATCTCTTGTGTGGGGAGTTTCATCCTAGCG GTTTGCCTGAGAATACAGATCAACCCACAGAACAAAGCGGATTTCCAAGGCATCTCCCCAGAGCGAGCCT TTGCTGATTTTCTCTTTGCCAGCACCATCCTGCACCTTGTTGTCATGAACTTTGTTGGC ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA TTACAAGGATGACGACGATAAGGTTTAA >RC200623 representing NM_001344
Red=Cloning site Green=Tags(s) MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILA VCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG TRRLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-NotI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001344 |
ORF Size | 339 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001344.4 |
RefSeq Size | 699 bp |
RefSeq ORF | 342 bp |
Locus ID | 1603 |
UniProt ID | P61803 |
Cytogenetics | 14q11.2 |
Domains | DAD |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, N-Glycan biosynthesis |
MW | 12.3 kDa |
Gene Summary | DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200623L1 | Lenti ORF clone of Human defender against cell death 1 (DAD1), Myc-DDK-tagged |
USD 450.00 |
|
RC200623L2 | Lenti ORF clone of Human defender against cell death 1 (DAD1), mGFP tagged |
USD 450.00 |
|
RC200623L3 | Lenti ORF clone of Human defender against cell death 1 (DAD1), Myc-DDK-tagged |
USD 450.00 |
|
RC200623L4 | Lenti ORF clone of Human defender against cell death 1 (DAD1), mGFP tagged |
USD 450.00 |
|
RG200623 | DAD1 (tGFP-tagged) - Human defender against cell death 1 (DAD1) |
USD 350.00 |
|
SC119316 | DAD1 (untagged)-Human defender against cell death 1 (DAD1) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review