FSTL1 (NM_007085) Human Tagged ORF Clone

CAT#: RC200586

FSTL1 (Myc-DDK-tagged)-Human follistatin-like 1 (FSTL1)

Change vector?

USD 98

USD 470


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FSTL1 (NM_007085) Human Tagged ORF Clone
Symbol FSTL1
Synonyms FRP; FSL1; MIR198; OCC-1; OCC1; tsc36
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200586 representing NM_007085
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGAAACGCTGGCTCGCGCTCGCGCTCGCGCTGGTGGCGGTCGCCTGGGTCCGCGCCGAGGAAGAGC
TAAGGAGCAAATCCAAGATCTGTGCCAATGTGTTTTGTGGAGCCGGCCGGGAATGTGCAGTCACAGAGAA
AGGGGAACCCACCTGTCTCTGCATTGAGCAATGCAAACCTCACAAGAGGCCTGTGTGTGGCAGTAATGGC
AAGACCTACCTCAACCACTGTGAACTGCATCGAGATGCCTGCCTCACTGGATCCAAAATCCAGGTTGATT
ACGATGGACACTGCAAAGAGAAGAAATCCGTAAGTCCATCTGCCAGCCCAGTTGTTTGCTATCAGTCCAA
CCGTGATGAGCTCCGACGTCGCATCATCCAGTGGCTGGAAGCTGAGATCATTCCAGATGGCTGGTTCTCT
AAAGGCAGCAACTACAGTGAAATCCTAGACAAGTATTTTAAGAACTTTGATAATGGTGATTCTCGCCTGG
ACTCCAGTGAATTCCTGAAGTTTGTGGAACAGAATGAAACTGCCATCAATATTACAACGTATCCAGACCA
GGAGAACAACAAGTTGCTTAGGGGACTCTGTGTTGATGCTCTCATTGAACTGTCTGATGAAAATGCTGAT
TGGAAACTCAGCTTCCAAGAGTTTCTCAAGTGCCTCAACCCATCTTTCAACCCTCCTGAGAAGAAGTGTG
CCCTGGAGGATGAAACGTATGCAGATGGAGCTGAGACCGAGGTGGACTGTAACCGCTGTGTCTGTGCCTG
TGGAAATTGGGTCTGTACAGCCATGACCTGTGACGGAAAGAATCAGAAGGGGGCCCAGACCCAGACAGAG
GAGGAGATGACCAGATATGTCCAGGAGCTCCAAAAGCATCAGGAAACAGCTGAAAAGACCAAGAGAGTGA
GCACCAAAGAGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200586 representing NM_007085
Red=Cloning site Green=Tags(s)

MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG
KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS
KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD
WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE
EEMTRYVQELQKHQETAEKTKRVSTKEI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007085
ORF Size 924 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007085.1, NM_007085.2, NM_007085.3, NM_007085.4, NP_009016
RefSeq Size 3705
RefSeq ORF 927
Locus ID 11167
Cytogenetics 3q13.33
Domains efhand, KAZAL, FOLN
Protein Families Secreted Protein
MW 34.99 kDa
Gene Summary This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations