Exonuclease 1(EXO1) (NM_130398) Human Tagged ORF Clone

CAT#: RC200547

EXO1 (Myc-DDK-tagged)-Human exonuclease 1 (EXO1), transcript variant 2

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Exonuclease 1(EXO1) (NM_130398) Human Tagged ORF Clone
Symbol EXO1
Synonyms HEX1; hExoI
Vector pCMV6-Entry
Sequence Data
>RC200547 representing NM_130398
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGATACAGGGATTGCTACAATTTATCAAAGAAGCTTCAGAACCCATCCATGTGAGGAAGTATAAAG
GGCAGGTAGTAGCTGTGGATACATATTGCTGGCTTCACAAAGGAGCTATTGCTTGTGCTGAAAAACTAGC
CAAAGGTGAACCTACTGATAGGTATGTAGGATTTTGTATGAAATTTGTAAATATGTTACTATCTCATGGG
ATCAAGCCTATTCTCGTATTTGATGGATGTACTTTACCTTCTAAAAAGGAAGTAGAGAGATCTAGAAGAG
AAAGACGACAAGCCAATCTTCTTAAGGGAAAGCAACTTCTTCGTGAGGGGAAAGTCTCGGAAGCTCGAGA
GTGTTTCACCCGGTCTATCAATATCACACATGCCATGGCCCACAAAGTAATTAAAGCTGCCCGGTCTCAG
GGGGTAGATTGCCTCGTGGCTCCCTATGAAGCTGATGCGCAGTTGGCCTATCTTAACAAAGCGGGAATTG
TGCAAGCCATAATTACAGAGGACTCGGATCTCCTAGCTTTTGGCTGTAAAAAGGTAATTTTAAAGATGGA
CCAGTTTGGAAATGGACTTGAAATTGATCAAGCTCGGCTAGGAATGTGCAGACAGCTTGGGGATGTATTC
ACGGAAGAGAAGTTTCGTTACATGTGTATTCTTTCAGGTTGTGACTACCTGTCATCACTGCGTGGGATTG
GATTAGCAAAGGCATGCAAAGTCCTAAGACTAGCCAATAATCCAGATATAGTAAAGGTTATCAAGAAAAT
TGGACATTATCTCAAGATGAATATCACGGTACCAGAGGATTACATCAACGGGTTTATTCGGGCCAACAAT
ACCTTCCTCTATCAGCTAGTTTTTGATCCCATCAAAAGGAAACTTATTCCTCTGAACGCCTATGAAGATG
ATGTTGATCCTGAAACACTAAGCTACGCTGGGCAATATGTTGATGATTCCATAGCTCTTCAAATAGCACT
TGGAAATAAAGATATAAATACTTTTGAACAGATCGATGACTACAATCCAGACACTGCTATGCCTGCCCAT
TCAAGAAGTCATAGTTGGGATGACAAAACATGTCAAAAGTCAGCTAATGTTAGCAGCATTTGGCATAGGA
ATTACTCTCCCAGACCAGAGTCGGGTACTGTTTCAGATGCCCCACAATTGAAGGAAAATCCAAGTACTGT
GGGAGTGGAACGAGTGATTAGTACTAAAGGGTTAAATCTCCCAAGGAAATCATCCATTGTGAAAAGACCA
AGAAGTGCAGAGCTGTCAGAAGATGACCTGTTGAGTCAGTATTCTCTTTCATTTACGAAGAAGACCAAGA
AAAATAGCTCTGAAGGCAATAAATCATTGAGCTTTTCTGAAGTGTTTGTGCCTGACCTGGTAAATGGACC
TACTAACAAAAAGAGTGTAAGCACTCCACCTAGGACGAGAAATAAATTTGCAACATTTTTACAAAGGAAA
AATGAAGAAAGTGGTGCAGTTGTGGTTCCAGGGACCAGAAGCAGGTTTTTTTGCAGTTCAGATTCTACTG
ACTGTGTATCAAACAAAGTGAGCATCCAGCCTCTGGATGAAACTGCTGTCACAGATAAAGAGAACAATCT
GCATGAATCAGAGTATGGAGACCAAGAAGGCAAGAGACTGGTTGACACAGATGTAGCACGTAATTCAAGT
GATGACATTCCGAATAATCATATTCCAGGTGATCATATTCCAGACAAGGCAACAGTGTTTACAGATGAAG
AGTCCTACTCTTTTGAGAGCAGCAAATTTACAAGGACCATTTCACCACCCACTTTGGGAACACTAAGAAG
TTGTTTTAGTTGGTCTGGAGGTCTTGGAGATTTTTCAAGAACGCCGAGCCCCTCTCCAAGCACAGCATTG
CAGCAGTTCCGAAGAAAGAGCGATTCCCCCACCTCTTTGCCTGAGAATAATATGTCTGATGTGTCGCAGT
TAAAGAGCGAGGAGTCCAGTGACGATGAGTCTCATCCCTTACGAGAAGGGGCATGTTCTTCACAGTCCCA
GGAAAGTGGAGAATTCTCACTGCAGAGTTCAAATGCATCAAAGCTTTCTCAGTGCTCTAGTAAGGACTCT
GATTCAGAGGAATCTGATTGCAATATTAAGTTACTTGACAGTCAAAGTGACCAGACCTCCAAGCTATGTT
TATCTCATTTCTCAAAAAAAGACACACCTCTAAGGAACAAGGTTCCTGGGCTATATAAGTCCAGTTCTGC
AGACTCTCTTTCTACAACCAAGATCAAACCTCTAGGACCTGCCAGAGCCAGTGGGCTGAGCAAGAAGCCG
GCAAGCATCCAGAAGAGAAAGCATCATAATGCCGAGAACAAGCCGGGGTTACAGATCAAACTCAATGAGC
TCTGGAAAAACTTTGGATTTAAAAAAGATTCTGAAAAGCTTCCTCCTTGTAAGAAACCCCTGTCCCCAGT
CAGAGATAACATCCAACTAACTCCAGAAGCGGAAGAGGATATATTTAACAAACCTGAATGTGGCCGTGTT
CAAAGAGCAATATTCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200547 representing NM_130398
Red=Cloning site Green=Tags(s)

MGIQGLLQFIKEASEPIHVRKYKGQVVAVDTYCWLHKGAIACAEKLAKGEPTDRYVGFCMKFVNMLLSHG
IKPILVFDGCTLPSKKEVERSRRERRQANLLKGKQLLREGKVSEARECFTRSINITHAMAHKVIKAARSQ
GVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGDVF
TEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVPEDYINGFIRANN
TFLYQLVFDPIKRKLIPLNAYEDDVDPETLSYAGQYVDDSIALQIALGNKDINTFEQIDDYNPDTAMPAH
SRSHSWDDKTCQKSANVSSIWHRNYSPRPESGTVSDAPQLKENPSTVGVERVISTKGLNLPRKSSIVKRP
RSAELSEDDLLSQYSLSFTKKTKKNSSEGNKSLSFSEVFVPDLVNGPTNKKSVSTPPRTRNKFATFLQRK
NEESGAVVVPGTRSRFFCSSDSTDCVSNKVSIQPLDETAVTDKENNLHESEYGDQEGKRLVDTDVARNSS
DDIPNNHIPGDHIPDKATVFTDEESYSFESSKFTRTISPPTLGTLRSCFSWSGGLGDFSRTPSPSPSTAL
QQFRRKSDSPTSLPENNMSDVSQLKSEESSDDESHPLREGACSSQSQESGEFSLQSSNASKLSQCSSKDS
DSEESDCNIKLLDSQSDQTSKLCLSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKP
ASIQKRKHHNAENKPGLQIKLNELWKNFGFKKDSEKLPPCKKPLSPVRDNIQLTPEAEEDIFNKPECGRV
QRAIFQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_130398
ORF Size 2538 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_130398.1, NM_130398.2, NM_130398.3, NP_569082
RefSeq Size 3245
RefSeq ORF 2541
Locus ID 9156
Cytogenetics 1q43
Domains XPG_N, XPG_I
Protein Families Stem cell - Pluripotency, Druggable Genome
Protein Pathways Mismatch repair
MW 93.9 kDa
Gene Summary This gene encodes a protein with 5' to 3' exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)